Der Impfreport

Neu im Programm –  der Impfreport!

Impfreport

Lies ihn im Original, dort ist er super aufbereitet.
http://www.initiative.cc/Artikel/2016_02_13_Impf-Report-109.pdf

Angelika Müller, Hans U. P. Tolzin EBOLA UNZENSIERT Fakten und Hintergründe, von denen Sie nichts wissen sollen Was Sie zum Thema Ebola in den Medien erfahren, ist das, was Sie über Ebola glauben sollen. In Wahrheit jedoch läuft derzeit hinter den Kulissen der vielleicht größte Wissenschaftsbetrug aller Zeiten ab. Mit von der Partie ist eine inzwischen global vernetzte medizinische Forschungsgemeinschaft (einschließlich bestimmter deutscher Institute), die eifrig eine drastische Selbstzensur betreibt, weil sie direkt oder indirekt am fi nanziellen Tropf einer mächtigen und fast unkontrollierbar gewordenen Industrie hängt. Ebola ist nach Ansicht von Angelika Müller und Hans Tolzin nicht die erste erfundene Seuche, könnte aber die letzte gewesen sein und zum entscheidenden Wendepunkt eines korrupten und vergewaltigten Gesundheitswesens werden. Es werden deshalb in diesem Buch einige wichtige, tiefgreifende Reformen vorgeschlagen. Das gigantische Lügengebäude rund um Ebola – und andere erfundene Seuchen – ist im Grunde sehr leicht zu durchschauen, wenn man weiß, wo man suchen muss. Gebunden / 236 Seiten / Best.-Nr. FBU-119 / € 17,95 Bert Ehgartner DIE HYGIENE-FALLE Schluss mit dem Krieg gegen Viren und Bakterien Die Grundprinzipien der Hygiene umzusetzen war eine der segensreichsten Leistungen unserer Zivilisation. Doch dann wurde der Krieg gegen die Keime zum Grundprinzip der Medizin erhoben. Bewaffnet mit Antibiotika, Impfungen & Co bekämpfen wir Viren und Bakterien und übersehen dabei, dass wir selbst aus solchen Mikroben bestehen – dem »Mikrobiom«, das eng mit unserem Immun- und Nervensystem kooperiert und für den Körper gleichbedeutend ist wie ein lebenswichtiges Organ. Bert Ehgartner (»Die Akte Aluminium«) beschreibt, wie uns eine fehlgeleitete Medizin in die »Hygienefalle« tappen lässt und welch dramatische Auswirkungen der Krieg gegen die Keime auf unsere Gesundheit hat. „Ich bin begeistert von diesem Buch!“ Dr. Martin Hirte, Kinderarzt „Dieses Buch sollte im Bücherregal aller Eltern stehen.“ Hans U. P. Tolzin, Medizin-Journalist Paperback / 260 Seiten / Best.-Nr. FBU-118 / € 19,90 Dr. Susanne Humphries (Autorin von „Impf-Illusionen“) DAS GESCHÄFT MIT DEN IMPFUNGEN Verheimlichte Fakten und unterdrückte Informationen Dr. Humphries stieß als Nierenspezialistin einer Klinik auf die Impf-Problematik. Dort erkrankten – und starben – Patienten kurz nach der Einlieferung. Die Ärztin fand heraus: Diese Menschen waren am Tag der Ankunft geimpft worden und hatten dadurch Nierenschäden erlitten. Als sie die Verantwortlichen der Klinik darauf ansprach, wiegelten diese ab. Die Impfungen wurden fortgesetzt. Dr. Humphries kündigte daher ihre Stelle und begann sich mit dem Thema näher zu beschäftigen. Dabei stellte sie fest: Immer wieder versuchten mutige Forscher und Ärzte, auf Wirkungslosigkeit und Risiken der Impfungen aufmerksam zu machen. Die Mediziner legten Fakten und Beweise vor. Jedoch: Die Studien, die Dr. Humphries auf dieser DVD präsentiert, wurden weitgehend unterdrückt, ihre Verfasser gemobbt. Eltern, die ihre Kinder nicht impfen lassen, werden oft wie Verbrecher behandelt. Doch das Verbrechen liegt nicht auf ihrer Seite! Video-DVD / Laufzeit: 84 Minuten / Best.-Nr. DVD-152 / € 12,95 Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 3 – impf-report Nr. 109 4. Quartal 2015 Impressum: Herausgeber und Redaktion Hans U. P. Tolzin, freier Journalist Titelbild: http://www.wikipedia.org Vertrieb Deutschland und Schweiz Tolzin Verlag, Widdersteinstr. 8 D-71083 Herrenberg Fon +49 (0) 7032 / 784849-1 Fax + 49 (0) 7032 / 78489-2 Email: buero@impf-report.de Vertrieb Österreich AEGIS Österreich A-8563 Ligist 89 Fax: +43 (0)3143/2973-4 Email: info@aegis.at, Erscheinungsweise: viermal im Jahr Die elektronische Ausgabe: Die elektronische Ausgabe (PDF-Datei) dieser Zeitschrift ist ausschließlich für Abonnenten bestimmt und darf ohne ausdrückliche Genehmigung des TolzinVerlags nicht an Dritte weitergeleitet werden. Ausnahme: Die Weitergabe einer einzelnen ausgedruckten Ausgabe. Hinweise: Namentlich gekennzeichnete Beiträge geben nicht unbedingt die Meinung der Redaktion wieder. Alle Texte ohne Gewähr. Irrtum und Druckfehler vorbehalten. Wir fordern unsere Leser ausdrücklich auf, jede in dieser Publikation abgedruckte Aussage, sei es pro oder kontra Impfen, sorgfältig zu prüfen! Die Redaktion übernimmt keine Verantwortung für die Folgen gesundheitlicher Entscheidungen, die sich auf diese Publikation berufen. Bitte ziehen Sie immer rechtzeitig einen Arzt oder Heilpraktiker Ihres Vertrauens zu Rate. Alle Rechte beim Tolzin Verlag bzw. den jeweiligen Autoren. Herrenberg, den 10. November 2015 Liebe Leser, wir erinnern uns: Andrew Wakefi eld ist jener Arzt, der 1998 zusammen mit 12 Kollegen in der renommierten Fachzeitschrift Lancet eine Studie über Autismus veröff entlichte und dabei den „Fehler“ beging, die Berichte der Eltern über einen engen zeitlichen Zusammenhang zwischen dem Entstehen des Autismus ihrer Kinder und einer vorherigen MMR-Impfung gegen Masern, Mumps und Röteln ernst zu nehmen. In einer Pressekonferenz hatte er Eltern geraten, vorsichtshalber Einzel impfstoff e statt den Dreifach-Impfstoff zu verwenden. Daraufhin waren die MMR-Durchimpfungsraten in England drastisch eingebrochen. Schließlich startete der Journalist Brian Deer 2004 in der Sunday Times eine „Enthüllungskampagne“ gegen Wakefi eld, die zum Rückzug der Publikation durch Lancet und zum Verlust seiner Approbation führte. Wakefi eld habe Bestechungsgelder von den Eltern angenommen, die Kinder für gefährliche Experimente missbraucht und Ergebnisse verfälscht. Die Co-Autoren Wakefi elds zogen sogar ihre Autorenschaft zurück. Der Ruf und die Karriere Wakefi elds waren nun zerstört. Soweit meine Recherchen bisher ergaben, ist nichts von den erhobenen Vorwürfen wahr. Z. B. hatten die Co-Autoren nur ihre Unterstützung eines möglichen Zusammenhangs mit der MMR-Impfung zurückgezogen, nicht aber, dass die Studie ihrer Ansicht nach einwandfrei durchgeführt worden war. Co-Autor Prof. Walker-Smith, damals weltweit führender Gastroenterologe, erstritt sogar vor Gericht seine vollständige Rehabilitation: Die Vorwürfe gegen die Studie und ihn als Co-Autor erwiesen sich als völlig haltlos. Wie mir Andrew Wakefi eld in einem Gespräch erzählte, hatte er selbst damals nicht die fi nanziellen Mittel, um ebenfalls durch die Instanzen zu gehen. Der Schaden war also, so schien es bis vor Kurzem, irreversibel angerichtet. Doch nun ist mit William Thompson ein führender Mitarbeiter der US-Seuchenbehörde CDC an die Öff entlichkeit getreten und gestand die Manipulation einer Studie ein, die Wakefi eld bzw. einen Zusammenhang zwischen Impfungen und Autismus ein für allemal widerlegen sollten. Er fordert den US-Kongress zur Einsetzung einer Untersuchungskommission auf, die von ihm sämtliche von ihm aufbewahrte Originaldaten zur Verfügung gestellt bekommen würde. Da bahnt sich ein Skandal ohnegleichen an. Doch bisher wird dieser Vorgang von den Behörden, den Massenmedien und der Politik ignoriert. Allein der Kongressabgeordnete Bill Posey hat sich den Forderungen Thompsons nach einer offi ziellen Untersuchung angeschlossen. Ob es wirklich dazu kommen wird, steht also noch nicht fest. Wir schreiben aber nicht mehr das Jahr 1998, sondern 2015. Die Macht der weitgehend von wirtschaftlichen Interessen gesteuerten Massenmedien ist durch das Internet und die modernen Medien weitgehend gebrochen – und das ist noch lange nicht das Ende der Entwicklung. Außerdem gibt es immer noch ein paar unabhängige Journalisten, wie z. B. Bert Ehgartner und unabhängige kleine Zeitschriften wie den impf-report. Lesen Sie in dieser Ausgabe Ehgartners Artikel über den Autismus-Skandal. Lesen Sie, was Ihnen die „Lügenpresse“ verschweigt, was Sie nicht über den wahrscheinlichen Zusammenhang zwischen Impfungen und der Autismus-Pandemie wissen sollen! herzlichst Ihr Hans U. P. Tolzin © privat – 4 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Inhaltsverzeichnis Editorial ……………………………………………………………………………………………………………………………………………….. 3 Inhaltsverzeichnis ………………………………………………………………………………………………………………………………. 4 Worauf kommt es bei einer Impfentscheidung an? …………………………………………………………………………. 5 Titelthema Impfungen & Autismus: Ein CDC-Insider packt aus! (Bert Ehgartner) ……………………………………….. 6 Erfundene Polio-Gefahren für besseren Impfstoff-Verkauf (Mike Adams) …………………………………….19 Multiple Sklerose als Impfschaden (Arbeitsgruppe IMPFormation AGI) ………………………………………….22 Wie Impfstoffe unser Immunsystem gegen uns aufbringen (Celeste McGovern) ………………………..25 Flüchtlingsimpfungen: Warum sagt uns die STIKO nicht die Wahrheit? (Angelika Müller) ………….33 ALS: Ein Heilungsbericht (anonym) …………………………………………………………………………………………………37 Öffentliche Stellungnahmen von differenziert impfenden Ärzten …………………………………………………40 Warum hat Japan 2013 die HPV-Impfung gestoppt? (Melissa Melton) …………………………………………..50 Autismus, ADHD/ADHS, Asthma: Welche Rolle spielt Paracetamol? (Sophie Middleton) ……………51 Neuer WHO-Leitfaden für die Bewertung von Impfkomplikationen (Hans U. P. Tolzin) ………………..54 PEI: „Kein Risiko durch Injektionen von Aluminiumverbindungen“ (Hans U. P. Tolzin) ………………55 Neuer Impfstoff gegen Volksseuche – Ausrottung bis 2025? (Hans U. P. Tolzin) ………………………….57 ASIA – eine neue Impfkrankheit (Hans U. P. Tolzin) …………………………………………………………………………58 Nachrichten aus der Schweiz (Netzwerk Impfentscheid) ………………………………………………………………….58 Impfkritische Gesprächskreise und Stammtische ………………………………………………………………………….60 Veranstaltungshinweise, Adressen & Links ……………………………………………………………………………………61 Nachruf: Gertrud Alexander ……………………………………………………………………………………………………………..62 11. Stuttgarter Impfsymposium am 9./10. April 2016……………………………………………………………………….63 Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 5 – impf-report Nr. 109 4. Quartal 2015 Worauf kommt es bei einer Impfentscheidung an? Viele Eltern sind durch offensichtliche Widersprüche innerhalb der offi ziellen Verlautbarungen zum Impfen verwirrt und suchen Klarheit für ihre Entscheidung. Nachfolgend deshalb einige Hinweise, die Ihnen bei Ihrer persönlichen Impfentscheidung eine Orientierung bieten können. von Hans U. P. Tolzin, Herausgeber der Zeitschrift „impf-report“ Der Rückgang der Seuchen Eines der Hauptargumente für die Durchführung der Massenimpfungen ist der Rückgang vieler Infektionskrankheiten im Laufe der vergangenen etwa 150 Jahre. Dies allein, so die oft geäußerte Ansicht, sei ja schon für sich ein Beweis für den Nutzen der Impfungen. Doch schaut man sich die Erkrankungsund Todesfallstatis tiken genauer an, dann beginnen die Massenimpfungen in der Regel erst dann, wenn die Kurven schon jahre- oder jahrzehntelang gefallen sind (siehe dazu impf-report Nr. 80/81). Dies sieht man z. B. sehr gut in verschiedenen Ländern anhand der Sterberaten aufgrund von Masern. Dieses Argument kann also nur schwerlich als Entscheidungshilfe hinzugezogen werden. Verschiedene Sprachen Die meisten Eltern verstehen unter „Wirksamkeit“ den Nachweis eines deutlichen gesundheitlichen Vorteils von Geimpften im direkten Vergleich mit Ungeimpften. Die dafür notwendigen Nachweise könnten über sogenannte placebokontrollierte Doppelblindstudien durchaus erhoben werden. Impf experten verstehen jedoch unter „Wirksamkeit“ etwas ganz Anderes, nämlich den Anstieg eines Laborwertes im Blut des Geimpften: Den „Antikörper-Titer“. Dieser reicht in der Regel für die Zulassung eines Impfstoff s aus. Doch Studien, die belegen, dass Menschen mit hohen Antikörpertitern gesünder sind als Menschen ohne Titer, konnten uns die Behörden bisher nicht vorlegen. Diese „Wirksamkeit“ basiert also auf einer über 100 Jahre alten medizinischen Hypothese, für deren Wahrheitsgehalt bis heute niemand einstehen kann. Das Ethik-Argument Zudem sei die Durchführung von vergleichenden Placebostudien ethisch nicht vertretbar, weil dadurch den Placebo-Geimpften der Impfschutz vorenthalten würde. Ein Argument, das vielen Menschen nicht einleuchtet. Auch mir nicht. Es ist also hilfreich, sich vor der Impfentscheidung darüber klar zu werden, was man selbst bezüglich der Wirksamkeit eines Impfstoff es erwartet. Kalkulierbares Risiko? Doch selbst, wenn Sie zu dem Schluss gekommen sind, dass ein bestimmter Impfstoff wirksam ist, muss der angenommene Nutzen ja noch gegen die Risiken der Impfung abgewogen werden. Wenn die Nebenwirkungen den Nutzen aufheben, macht eine Impfung ja keinen Sinn mehr. Dazu schreibt das Paul-Ehrlich-Institut (PEI) als zuständige Zulassungsbehörde im Bundesgesundheitsblatt wörtlich: „Da die Untererfassung der Meldungen von Impfkomplikationen nicht bekannt oder abzuschätzen ist und keine Daten zu verabreich ten Impfungen als Nenner vorliegen, kann keine Aussage über die Häu- fi gkeit bestimmter unerwünschter Reaktionen gemacht werden.“ Die Frage der Kalkulierbarkeit des Risikos ist also nicht so eindeutig zu beantworten, wie vielleicht anfangs gedacht. Realistische Risiken? Bis 2009, dem Jahr der Schweinegrippe, sprach das Robert-Koch-Institut (RKI), die Bundesseuchenbehörde, in ihren Publikationen regelmäßig von jährlich durchschnittlich 10.000 Infl uenza-Todesfällen in Deutschland. Dies war die Hauptbegründung für die behauptete Notwendigkeit der Grippe-Impfung. Doch während der Schweinegrippe wurden die Todesfälle erstmals richtig gezählt, und zwar waren es in dieser Saison weniger als 300 Todesfälle. Entweder stimmt also die frühere Schätzung des RKI nicht oder aber die Gefährlichkeit des Infl uenzavirus ist plötzlich auf ein Bruchteil gesunken. In beiden Fällen müsste die Notwendigkeit der Impfung neu bewertet werden. Dies ist jedoch bisher nicht geschehen. Warum nicht? Alternativen Auch dann, wenn es Alternativen der Vorsorge gibt, müsste die Notwendigkeit des Impfens neu bewertet werden. Gerade beim Beispiel Infl uenza nimmt die Anzahl der Studien zu, die belegen, dass Erkältungserkrankungen in erster Linie auf einem jahreszeitbedingten Mangel an Vitamin D beruhen. Die Mehrzahl der Deutschen hat in ihrem Blut zu wenig von diesem Sonnenvitamin, das eine wichtige Rolle für das Immunsystem spielt. Ein Umstand, den die zuständigen Behörden nicht berücksichtigen. Warum nicht? Fazit Vielleicht sehen Sie nun, dass eine intensivere Auseinandersetzung mit dem Pro und Kontra des Impfens angezeigt sein könnte, um Ihrer Verantwortung für die Gesundheit Ihrer Kinder besser gerecht zu werden. Weiterführende Informationen fi nden Sie auf der Webseite www. impfkritik.de und in meinem Buch „Macht Impfen Sinn, Band 1“, erhältlich über unseren Webshop oder den Buchhandel. – 6 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Die Frage, ob das Ansteigen der Fälle von Autismus etwas mit der zunehmenden Zahl von Impfungen zu tun haben könnte, sorgt in der Öff entlichkeit, speziell aber auf den Kommentarseiten der Online-Medien sowie in den sozialen Netzwerken, regelmäßig für wü- tende Gefechte. Im offi ziellen Nebenwirkungsmeldesystem der USA fi nden sich unzählige Berichte von Ärztinnen und Ärzten sowie betroff enen Eltern über einen zeitlich engen Zusammenhang zwischen ersten Symptomen einer Entwicklungsstörung und Impfterminen. Mittlerweile gibt es mehrere große Vereinigungen, die von betroff enen Eltern gegründet wurden und abseits der regulären Gesundheitsorganisationen Forschungsaufträge erteilen, Medienarbeit machen und Fallberichte ihrer Mitglieder veröff entlichen. Auf solchen Seiten wird unter anderem berichtet, wie die autistischen Stö- rungen bei den Kindern begannen. Da wird beispielsweise beschrieben, dass Babys auf Impfungen mit lang anhaltendem, schrillem Schreien reagiert hatten und danach ihre Köpfchen nicht mehr wie zuvor selbst halten konnten. Andere berichten, dass Babys aufhörten zu sprechen und erste Wörter wieder vergaßen. Prominente Unterstützer wie der Hollywood-Schauspieler Jim Carrey, der selbst einen autistischen Sohn hat, treten auf Autismus-Veranstaltungen auf Impfungen & Autismus: Ein CDC-Insider packt aus! Tausende von Eltern autistischer Kinder, insbesondere in den USA, dem Land mit dem dichtesten Impfkalender, berichten seit Jahren von einem engen zeitlichen Zusammenhang mit vorausgegangenen Impfungen. Doch bis heute weigern sich die Gesundheitsbehörden weltweit, diesen möglichen Zusammenhang ergebnisoffen zu untersuchen. Im Gegenteil: Die Karriere von Wissenschaftlern, die dies versuchen, wird systematisch zerstört, wie das Beispiel des englischen Gastroenterologen Andrew Wakefi eld zeigt. Doch nun bahnt sich eine Wende an: William Thompson, ein führender Mitarbeiter der US-Seuchenbehörde CDC, ist mit einer erstaunlichen Beichte an die Öffentlichkeit getreten. Demnach wurden Studienergebnisse vom CDC vorsätzlich gefälscht, um die ursächliche Rolle von Impfungen zu vertuschen. von Bert Ehgartner, Medizinjournalist dieser Artikel ist ein Auszug aus seinem neuesten Buch „Die Hygienefalle“ Autistische Kinder sind in der Regel in ihrer eigenen Welt gefangen. Ihre Fähigkeit, sich in der „normalen“ Umgebung zurechtzufi nden und mit Menschen zu kommunizieren, ist stark reduziert. Typisch für autistische Kinder ist der Verlust des Blickkontaktes. Es gibt nur wenige Autisten, die in der Lage sind, sich selbständig zu versorgen. In den USA ist bereits jedes 68. Kind betroff en. Im Grunde handelt es sich um eine der größten Epidemien der Neuzeit. © Sangoiri – fotolia.com Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 7 – impf-report Nr. 109 4. Quartal 2015 und sorgen für große mediale Aufmerksamkeit. Die Behörden widersprechen, beruhigen und bezeichnen derartige Schilderungen als anekdotische Einzelfälle ohne Aussagekraft. Doch die Autismus-Gruppen sind mittlerweile in den USA allein aufgrund der Häufi gkeit dieser Störung zu einer nicht mehr zu überhörenden Partei geworden. Inzwischen herrscht zwischen den Autismus-Organisationen und den Behörden ein heftiges Misstrauen, wenn es um den Anteil geht, den Impfungen an dieser Katastrophe haben könnten. Wer allzu off en an diese Frage herangeht, kann seine Forschungskarriere riskieren, wie das Beispiel des einst hoch angesehenen britischen Gastroenterologen Andrew Wakefi eld belegt. Der Fall Wakefi eld Wakefi eld war einer der ersten Wissenschaftler, die den Zusammenhang zwischen chronischen Störungen im Darm und dem Auftreten von Autismus untersuchten. In einer 1998 im Journal Lancet publizierten Arbeit stellte er zwölf Fälle von autistischen Kindern mit Darmstörungen vor. Zum Verhängnis wurde ihm die öff entlich thematisierte Frage, ob die Masern-Mumps-Röteln-Impfung (MMR) ein möglicher Auslöser für die Krankheit sein könnte. Die Medien verbreiteten seine These, und die Impfquote bei MMR fi el in Großbritannien dramatisch ab. In der Folge kam es zu Masernausbrüchen. Impfexpertinnen und -experten gingen genauso wie die Medien daraufhin zum Gegenangriff über: Wakefi eld wurden unter anderem unethische Forschungsmethoden sowie die Nichtdeklaration von Spendengeldern in Höhe von 50.000 Pfund vorgeworfen, Kolleginnen und Kollegen distanzierten sich öff entlich. Wakefi elds wissenschaftlicher Ruf wurde im Zuge dieser Debatte zerstört. Der Mediziner verlor seinen Job und musste mit seiner Familie England verlassen. 2010 wurde gegen ihn sogar ein Berufsverbot in Großbritannien verhängt. Heute arbeitet Andrew Wakefi eld im Auftrag privater Autismus-Forschungseinrichtungen in den USA. In Interviews, Vorträ- gen und Büchern hat er zu allen Anschuldigungen detailliert Stellung genommen und alle Vorwürfe scharf zurückgewiesen. So habe er etwa die 50.000 Pfund Förderung sofort der Finanzabteilung seiner Universität gemeldet und sie niemals verheimlicht. Dass er dem Journal Lancet die Förderung nicht gemeldet hat, stimme zwar, die Off enlegung wurde damals vom Journal aber auch gar nicht verlangt, zumal die Förderung eine andere wissenschaftliche Arbeit betraf, die nichts mit dem Lancet-Artikel zu tun hatte. Ich möchte hier nicht auf weitere Details dieser Aff äre eingehen; für mich klingen Wakefi elds Argumente aber plausibel. Wer sich selbst ein Bild machen möchte, kann die Anschuldigung sowie die Entgegnungen in den genannten Quellen nachlesen.1,2 Was Andrew Wakefi eld passierte, ist zwar das prominenteste, aber bei Weitem nicht das einzige Beispiel für Leute, die impfkritische Themen an die Öff entlichkeit brachten und augenblicklich einer Welle von Kritik und Unterstellungen ausgesetzt waren. Ich persönlich denke nicht, dass die MMR-Impfung eine wesentliche Ursache für Autismus darstellt. Aber selbst wenn sie nur einer von vielen Auslösern sein sollte, müssen die biochemischen Abläufe aufgeklärt werden. Bei einer Maßnahme wie dem Impfen, die ja 100 Prozent aller gesunden Kinder empfohlen wird, muss gesichert sein, dass diese nach dem Impftermin ebenso gesund sind wie zuvor. Und dafür ist es notwendig, auch seltenen Risiken nachzugehen und sie vorurteilsfrei zu prüfen. Die gegenwärtige Tendenz, gar keine wissenschaftliche Diskussion zuzulassen, als wäre das Impfwesen die „heilige Kuh“ der Wissenschaft, halte ich für absolut unwürdig. Kürzlich gab Wakefi eld in einem Interview folgenden bemerkenswerten Kommentar: „Es gibt immer mehr Angriff e auf Ärzte und Wissenschaftler, die noch im Interesse ihrer Patienten arbeiten und nicht im Interesse von Gesundheitspolitik oder Industrie. Es gibt extrem schonungslose Attacken auf jene paar verbliebenen Wissenschaftlerinnen und Wissenschaftler, die derzeit zum möglichen Zusammenhang von Impfungen mit Entwicklungsstörungen wie Autismus überhaupt noch kritische und unvoreingenommene Forschung betreiben. Das sind weltweit gerade einmal fünf bis zehn Leute. Wenn wir diese Leute nicht beschützen, werden wir bald niemanden mehr haben, der sich mit kritischen Daten an die Öff entlichkeit traut. Denn ihre Karriere wird gnaden- Über den Autor: Bert Ehgartner ist freier Wissenschaftsjournalist, Dokumentarfi l mer und Buchautor. Er studierte in Wien Publizistik, Politikwissenschaften und Informatik (ohne Abschluss). Seit 1987 arbeitet er als freier Journalist. Er schrieb mehrere Bücher, darunter „Lob der Krankheit: Warum es gesund ist, hin und wieder krank zu sein“ und „Gesund bis der Arzt kommt“. Bekannt wurde er vor allem durch sein Buch „Dirty little secret – die Akte Aluminium“ und seinen gleichnamigen Dokumentarfi lm, der u. a. in ZDF/ ARTE, ORF und SRF ausgestrahlt wurde. Ehgartner ist verheiratet, Vater von fünf Kindern und lebt mit seiner Familie in der Nähe von Wien. – 8 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 los zerstört. Sie verlieren den Boden unter ihren Füßen, sie verlieren alles, so wie ich alles verloren habe. Wir müssen jetzt aufstehen, als wissenschaftlich Tätige, als Gesellschaft, als Community, und diese Menschen beschützen. Wir müssen die Hetzjagd beenden.“3 Chronische Entzündung Innerhalb der Wissenschaft kam es zu Wakefi elds These, dass lebende Viren aus Impfungen bei der Untergruppe der autistischen Kinder mit Reizdarm eine Rolle spielen könnten, nie zu einer offenen Diskussion, sondern meist nur zu einem wütenden Schlagabtausch. „Seine Idee führte zu einer heftigen Kontroverse“, erinnert sich Anna Strunecká, „diese wurde jedoch nicht mit wissenschaftlichen Argumenten geführt.“ Prinzipiell scheint ihr Wake- fi elds These biologisch plausibel, zumal auch wilde Masern- und Rö- telviren als mögliche Trigger von Autismus diskutiert werden.4 Wenn wilde Viren das können, warum sollte das bei abgeschwächten, aber immer noch lebenden Viren ausgeschlossen sein? Infekte stehen als Auslöser zahlreicher Autoimmunerkrankungen unter Verdacht. Jeder Infekt stimuliert das Immunsystem, und jede Immunreaktion bringt auch gegen den eigenen Körper gerichtete Auto-Antikörper hervor. Normalerweise werden diese problematischen Eiweißpartikel von den internen Sicherheitsmechanismen des Immunsystems rasch beseitigt. Doch sind biologische – genau wie technische – Kontrollsysteme niemals hundertprozentig perfekt. Bei entsprechender Veranlagung oder einer vorangegangenen Schwä- chung des Immunsystems könnte es durchaus zu einer Verfestigung der Autoimmunreaktion kommen. Dabei heften sich die fehlgesteuerten Antikörper an körpereigene Zellen, markieren diese als „fremd“ und „gefährlich“, und geben sie damit für die grob geschnitzten „natürlichen Killerzellen“, die Makrophagen und anderen Fresszellen des Immunsystems, zum Abschuss frei. Geschieht diese Fehlmarkierung im Gehirn, würde das Immunsystem auf die derart gekennzeichneten Nervenzellen losgehen. Das würde die in Untersuchungen an Autismuskranken gefundenen schweren Entzündungen und Fehlvernetzungen im Gehirn erklären. Tatsächlich wurde in Gehirnen verstorbener Autistinnen und Autisten eine extrem hohe Dichte an Zellen des Immunsystems gefunden. Das weist auf eine zu Lebzeiten bestehende chronische Entzündung hin. Noch viel stärker ist dieser Effekt bei Aluminiumsalzen in Totimpfstoff en. Diese Wirkverstärker werden einzig zu dem Zweck beigefügt, die Immunreaktion zu verstärken. Lebendimpfstoff e wie MMR müssen nicht verstärkt werden, da die Viren ja leben und das Immunsystem deshalb ganz von selbst auf sie reagiert. NormalerAls die von Andrew Wakefi eld 1998 angestoßene öff entliche Diskussion über die MMR-Impfung als mögliche Ursache von Autismus zu deutlichen Einbrüchen der Impfrate führte, begann eine vom Journalisten Brian Deer und der Sunday Times angeführte Hetzkampagne gegen Wakefi eld. Er verlor seinen guten Ruf, seinen Job und schließlich seine Zulassung. Seine Publikation wurde von Lancet zurückgezogen. Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 9 – impf-report Nr. 109 4. Quartal 2015 weise sollte diese Reaktion viel milder ausfallen als bei Aluminium, zum einen, weil die Viren abgeschwächt sind, zum anderen, weil das Immunsystem diese Viren aus der gemeinsamen evolutionären Vergangenheit schon kennt. Außerdem steht MMR erst rund um den ersten Geburtstag auf dem Impfplan, zu einem Zeitpunkt also, zu dem das Immunsystem der Babys schon deutlich besser entwickelt ist – so es nicht vorgeschädigt wurde. Die „westliche Krankheit“ Immer wieder gibt es Versuche, die Autismus-Epidemie wegzuerklären. Sie sei vielleicht gar nicht real, sondern ein Produkt der hö- heren Aufmerksamkeit für diese Symptome, heißt es da manchmal – wo näher hingesehen werde, werde eben auch mehr gefunden. Inzwischen hat die oberste US-Gesundheitsbehörde CDC (Centers for Disease Control) jedoch selbst in ihren Untersuchungen die enorme Zunahme bestätigt: Während in den Siebzigerjahren des vergangenen Jahrhunderts etwa ein bis zwei Fälle pro 10.000 Kindern auftraten, wurde zu Beginn des neuen Millenniums bereits eines von 166 amerikanischen Kindern mit einer autistischen Störung diagnostiziert. Diese enorme Zahl beruht nicht auf Schätzungen, sondern auf einem eigens dafür eingerichteten Monitoring-Netzwerk, das in elf Regionen der USA die Kinder aktiv überwacht und nach einem einheitlichen Diagnoseschlüssel auf Krankheiten des autistischen Spektrums überprüft. Getestet werden Kinder im Alter von acht Jahren, weil zu diesem Zeitpunkt die Entwicklungsstörung in den allermeisten Fällen bereits off ensichtlich ist. Im März 2014 veröff entlichte die CDC die bislang letzten Zahlen des Netzwerks. Und abermals zeigte die Kurve steil nach oben: Inzwischen ist eines von 68 Kindern in den USA von Autismus betroff en, bei Jungen sogar einer von 42. Und es gibt Untergruppen, die noch anfälliger sind: Aus Somalia in die USA Eingewanderte haben beispielsweise ein Risiko von 1 zu 25, dass ihre Kinder autistisch werden. Zu Hause in Afrika kannten die Leute nicht einmal den Namen dieser Störung. Somalis nennen Autismus deshalb „die westliche Krankheit“. Wie ist ein derart dramatischer Anstieg erklärbar? Wie kann eine Krankheit, die noch vor einigen Jahrzehnten als exotisch galt, in derartige Höhen schießen? Eigentlich wäre die Beantwortung dieser Frage die ureigenste Aufgabe der Gesundheitsbehörden. Hier arbeiten schließlich weltweit tausende gut bezahlte und hoch qualifi zierte Fachleute im Dienste der Öff entlichkeit. Doch wie wir im Folgenden sehen werden, sind die Behörden in Bezug auf ihre Aufgaben off enbar ganz anderer Meinung. Das CDC-Komplott Ich habe meine Meinung zum Arbeitseifer, der Zivilcourage und dem Verantwortungsbewusstsein der Gesundheitsbehörden in Deutschland, Österreich und der EU mehrfach öff entlich kundgetan und wurde deshalb von manchen als Scharfmacher, Rüpel und Beamtenfresser tituliert. Deshalb will ich mich in diesem Kapitel ein wenig zurückhalten – auch wenn es schwerfällt. Sagen wir es also so: Die taktische Lage für die Gesundheitsbehörden ist nicht gerade einfach. Auf der einen Seite werden von ihnen seit vielen Jahrzehnten Impfungen empfohlen und die Impfpläne immer dichter mit Terminen vollgepackt. Auf der anderen Seite häufen sich Berichte in Medien, Selbsthilfegruppen und Foren über Impfschäden, und Stimmen, die diesem Impf-Bombardement kritisch gegenüberstehen, werden immer lauter. Der Großteil der neuen Impfstoff e, die nach Europa kommen, stammt von Herstellern aus den USA. Der weltweit mit Abstand meistverkaufte Impfstoff , Prevenar 13 gegen Pneumokokken-Infektionen von Pfi zer, brachte es im Jahr 2014 auf einen Umsatz von 4,5 Milliarden US-Dollar. An zweiter Stelle rangiert der erst 2007 eingeführte HPV-Impfstoff Gardasil (1,9 Milliarden), der den Konzern Merck zum weltweit größten Impfstoff hersteller machte. Merck erzielte zuletzt 6,3 Milliarden US-Dollar aus dem Umsatz seiner Impfstoff sparte. In Europa gibt es nur noch das britische Unternehmen GlaxosSmithKline (GSK), den franzö- sischen Konzern und Merck-Partner Sanofi sowie das in Basel ansässige Unternehmen Novartis, das seine Impfstoff sparte zuletzt aber radikal abgebaut und an die Konkurrenz (vor allem GSK) verkauft hat. Alle anderen Impfstoff – hersteller spielen in der Unterklasse. Die großen Vier – Merck, Pfi zer, GSK und Sanofi – teilen sich also den Weltmarkt, speziell den hochpreisigen Bereich in den Industriestaaten Nordamerikas und Europas. Die Impfstoff hersteller sichern sich ab Die USA sind also auch im Bereich Impfstoff e unumstrittene Supermacht. Was von US-Behörden zugelassen wird, geht normalerweise problemlos auch durch die Zulassung der EU. Konkurrenzdenken, Widerspruch oder gar eigenständige Expertise ist weit und breit nicht in Sicht. In kaum einem Bereich ist die Führungsautorität der Vereinigten Staaten so unumstritten. Deshalb ist es auch für uns 3. Quartal 2013 D: € 9,00 Nr. 100 CHF 13,50 A: € 9,45 In dieser Ausgabe: Die Masern-Impfung, Teil 2 Impfen und Autismus Freie Wahl der Hebammen in Gefahr Die Akte Andrew Wakefield: Kann die MMR-Impfung Autismus verursachen? Weitere Hintergrundinformationen zur öff entlichen Demontage von Andrew Wakefi eld fi nden Sie in der impf-report-Ausgabe Nr. 100. – 10 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 hoch relevant, wie US-Gesundheits- und Arzeimittelbehörden ticken und nach welchen Spielregeln dort die Sicherheit der Impfstoff e kontrolliert wird. Von besonderem Interesse ist ihr Umgang mit tatsächlichen oder behaupteten Impfschäden. In den 1980er-Jahren häuften sich die Klagen gegen Impfstoff hersteller wegen unerwünschter Nebenwirkungen und bleibender Schäden. Spezialisierte Kanzleien brachten Sammelklagen ein, und es war abzusehen, dass es hier um ähnlich gigantische Summen gehen könnte wie bei den großen Prozessen gegen die Tabakindustrie. Die Hersteller reagierten darauf mit der Drohung, sich gänzlich aus der Impfstoff produktion zurückzuziehen, wenn sie von den Gesetzgebern keinen Schutz bekämen. Den gab es umgehend: 1988 wurde das „National Childhood Vaccine Injury Compensation Program“ (NVICP) Gesetz. Es bedeutet nichts anderes, als dass es seither in den USA nicht mehr möglich ist, einen Impfstoff hersteller zu verklagen. Auf jede Impfung wird eine Steuer aufgeschlagen, die in einen gemeinsamen Schadenstopf wandert, aus dem eventuelle Ansprüche beglichen werden. Wer eine Impfung kauft, zahlt also gleich solidarisch für alle mit, die eventuell dadurch geschädigt werden. Bis heute wurden mehr als 3,5 Milliarden US-Dollar in den Topf eingezahlt. Bei Krankheiten oder Tod als möglicher Folge einer Impfung müssen Entschädigungen nun per Antrag an staatliche Behörden reklamiert werden. Jeder Einzelfall wird über Gutachten und spezialisierte Kanzleien entschieden, die ebenfalls aus Steuern bezahlt werden. Bisher fl ossen rund drei Milliarden US-Dollar an Impfgeschädigte oder deren Hinterbliebene zurück – nicht eben wenig für eine angeblich nebenwirkungsfreie Maßnahme. Die Hersteller haben sich freigespielt. Im Gegensatz zu allen anderen Sparten der Wirtschaft haben sie kein juristisches Risiko mehr, weil sie nicht mehr haftbar gemacht werden können für eventuelle Schäden aus ihren Produkten. Es ist kein Zufall, dass ein Boom neuer, hochpreisiger Impfstoff e einsetzte. Gleichzeitig brodelte es zur Jahrtausendwende fortwährend in den Medien, dass Impfungen schuld am rasanten Anstieg der Autismusfälle sein könnten. Unter Verdacht stand – wegen der Studien Wakefi elds – zum einen die Masern-Mumps-Röteln-Impfung mit Lebendviren. Zum anderen gerieten die weitaus zahlreicheren Totimpfstoff e ins Visier, die meist die Quecksilberverbindung Thiomersal als KonservierungsDer Enkel des republikanischen Kongressabgeordneten Dan Burton (oben) wurde zwei Tage nach einer 9-fach-Impfung zum Autisten. 2002 leitete Burton eine öff entliche Anhörung über die Sicherheit von quecksilberhaltigen Impfstoff en. Weder William Egan, Direktor der US-Zulassungsbehörde FDA (Mitte) noch Dr. Karen Mithun, FDA-Verantwortliche für die Impfstoff e, waren während dieser Anhörung in der Lage, Studien zu benennen, welche die Sicherheit des quecksilberhaltigen Zusatzstoff s Thiomersal belegen konnten. (Quelle: youtube.com) Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 11 – impf-report Nr. 109 4. Quartal 2015 mittel sowie Aluminiumsalze als Wirkverstärker enthielten. Quecksilber und Aluminiumsalze sind zwei bekannt toxische Substanzen. Solche Gifte als Bestandteil von Babyimpfungen einzusetzen, war auf Dauer in der Öff entlichkeit schwer zu rechtfertigen; also waren die staatlichen Behörden gezwungen, sich mit dem Problem zu befassen. Es kam zu zahlreichen internen Untersuchungen. In den USA wurden vor allem von der staatlichen CDC Studien zur Frage der Impfstoff sicherheit organisiert. Doch wer nun glaubt, sie täte das im Sinne der Menschen, die sie eigentlich vertreten sollte, irrt. Die Papiere von Simpsonwood Ein Sittenbild von Behördengepfl ogenheiten liefert das 286 Seiten umfassende Gesprächsprotokoll einer Veranstaltung im Simpsonwood-Konferenzzentrum in Norcross, Georgia, bei der im Juni 2000 zwei Tage lang über einen möglichen Zusammenhang von quecksilber- und aluminiumhaltigen Impfstoff en und neurologischen Entwicklungsstörungen diskutiert wurde.5 Eingeladen waren nicht nur Impfexpertinnen und -experten der CDC, Vertretungen der Regierung und der WHO, sondern auch die Pharmaindustrie. Alle, die an dem Meeting teilnahmen, wurden zu absoluter Verschwiegenheit verpfl ichtet. Dass das Protokoll der Sitzung dennoch an die Öff entlichkeit gelangte, ist das Verdienst einer Autismus-Elterninitiative, die gerüchteweise davon erfuhr und die Dokumente auf Basis des „Freedom of Information Act“ gerichtlich ausheben ließ.6 Der Anlass für das Meeting war eine bis dahin unveröff entlichte Studie der CDC, geleitet von Tom Verstraeten. Der aus Gent in Belgien stammende Epidemiologe hatte den Auftrag bekommen, die Daten von mehr als 400.000 Kindern auszuwerten und auf eine mögliche Verbindung von Impfungen mit neurologischen Entwicklungsstörungen zu untersuchen. Schon ein halbes Jahr vor dem Treff en informierte Verstraeten seine Kollegen und Vorgesetzten über alarmierende Resultate. Besonders die sehr frühen Impfungen, wie sie in den USA auch während der 1990er-Jahre schon üblich waren, hatten oft dramatische Folgen. Bei Babys, die im ersten Lebensmonat quecksilberhaltige Impfungen bekommen hatten – die übrigens immer auch Aluminium enthielten, doch das Auszug aus den Simpsonwood-Protokollen. Auf Seite 41-42 berichtet Dr. Verstraeten, dass laut Studienergebnissen das Risiko für neurologische Entwicklungsstörungen mit jedem Mikrogramm Thiomersal um 0,7 Prozentpunkte ansteigt. Quelle: http://www.autismhelpforyou.com Kurzversion der Studienergebnisse, die von Tom Verstraeten im Vorfeld der Simpsonwood-Konverenz an die Teilnehmer verschickt worden war. Quelle: SafeMinds (nach dem Freedom-of-Information-Act gerichtlich ausgehoben) – 12 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 war nicht Gegenstand der Untersuchung –, ergab sich im Vergleich zu Kindern, die im ersten Monat nicht geimpft wurden, ein mehr als siebenfach höheres Autismusrisiko. Verstraeten hatte zu diesem Zeitpunkt bereits alle möglichen statistischen Methoden versucht, um diesen Eff ekt in den Griff zu bekommen, aber „er geht einfach nicht weg“, schrieb er in einer internen Mail. „Wie ihr seht, ist das Risiko in einigen Kategorien deutlich erhöht“, darunter nicht nur Autismus, sondern auch ADHS, Ticks, Schlaf- und Sprachstö- rungen, „und ich habe bisher keine alternative Erklärung gefunden. (…) Wie es aussieht, wird der Schaden im ersten Lebensmonat angerichtet.“ In seinem Vortrag erklärte Verstraeten, dass er in seiner Arbeit die Metallbelastung aus Impfungen erhoben und in Beziehung zu den gesundheitlichen Störungen der Kinder gesetzt hatte. Abgesehen von der Polio-Schluckimpfung waren damals sowohl in den USA als auch in Europa in jedem Babyimpfstoff Quecksilber und Aluminium enthalten. Verstraeten erklärte den geschockten Anwesenden, dass es einen signifi kanten und linearen Zusammenhang zwischen der Quecksilberbelastung und den Entwicklungsstörungen gab. Für jedes Mikrogramm Thiomersal, das die Babys abbekommen hatten, stieg das Krankheitsrisiko um 0,7 Prozent. Am deutlichsten war der Trend für Sprachverzögerungen, gefolgt von ADHS (Aufmerksamkeitsde- fi zit-/Hyperaktivitätsstörung) und Autismus. Dass die Experten die Daten hoch dramatisch fanden, zeigt eine Begebenheit am Rande: Mitten in der Sitzung sprang der Immunologe Robert Johnson auf. Er habe gerade erst die Nachricht von der Geburt seines ersten Enkelsohnes erhalten. Er müsse sofort los und unbedingt verhindern, dass sein Enkel eine Spritze bekommt, die Thiomersal enthält. Die Übrigen diskutierten lebhaft weiter – speziell über die Bedeutung, die eine derartige Veröff entlichung für den Ruf der Impfungen in der Öff entlichkeit sowie einige anstehende Strafprozesse hätte. „Die medizinisch-legalen Konsequenzen dieser Studie sind entsetzlich“, äußerte sich etwa der Entwicklungsbiologe und Kinderarzt Robert Brent von der Jeff erson University. „Damit sind wir in einer schlechten Position, um Gerichtsverfahren abzuwehren. Ich bin wirklich besorgt.“ Es wurden zahlreiche Überlegungen angestellt, wie das Ergebnis am besten zu kommunizieren sei, um den Imageschaden zu minimieren. Philip Rhodes, im Studienteam für die Statistik zuständig, erklärte, wie Einfl uss auf die Ergebnisse ausgeübt werden könnte, beispielsweise indem Frühgeborene oder Kinder, die weniger Impfungen bekommen hatten, aus der Auswertung ausgeschlossen würden. Doch sowohl er selbst wie auch Verstraeten und andere Statistiker hatten bereits viele Monate lang über der Auswertung der Daten gesessen. „Du kannst sie stoßen, ich kann sie ziehen. Aber hier hat schon eine ganze Menge Bewegung stattgefunden, sodass wir von einer enormen Signifi kanz zu einem grenzwertigen Resultat gekommen sind.“ Vielmehr, so Rhodes, sei in diesem Stoß-mich-zieh-dich-Datenkarussell einfach nicht mehr drin. Die Behörde gibt Entwarnung Das Protokoll der Sitzung vom Juni 2000 enthält noch viele weitere ähnlich erschreckende Äußerungen. Die Verantwortlichen der wichtigsten Gesundheitsbehörden überlegten nicht etwa, wie Kinder vor negativen Einfl üssen geschützt werden können. Sie berieten, wie sie den Ruf der Impfungen schützen könnten – und natürlich auch ihren eigenen. Es dauerte mehr als drei Jahre, bis die Studie von Tom Verstraeten und Kollegen schließlich im angesehenen Fachjournal Pediatrics veröff entlicht wurde. Und scheinbar war statistisch doch noch Einiges möglich gewesen: Denn als sie das Licht der internationalen Fachwelt erblickte, waren keine alarmierenden Zahlen oder signiDer Psychologe und Epidemiologe Dr. William Thompson konnte es nicht mehr mit seinem Gewissen vereinbaren, über die Vertuschungsaktionen seiner Behörde zu schweigen. Quelle: http://www.thinkingmomsrevolution.com Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 13 – impf-report Nr. 109 4. Quartal 2015 fi kanten Zusammenhänge mehr zu erkennen; bloß ein paar kleine regionale Irritationen bei „nervösen Ticks“ und „Sprachverzögerung“, die mit Nachfolgestudien abgeklärt werden sollten. Für Autismus und ADHS war die Entwarnung absolut.7 Einer pikanten Ergänzung bedurfte es freilich noch in der folgenden Ausgabe des Journals: Der Hauptautor der Studie, Thomas Verstraeten, der im Text als Mitarbeiter der US-Gesundheitsbehörde CDC bezeichnet worden war, hatte nämlich zufällig vergessen bekanntzugeben, dass er seit mehr als einem Jahr die Seiten gewechselt hatte und nun für den Impfstoff konzern GlaxoSmithKline tä- tig war. Off enbar hat dem Konzern imponiert, wie Verstraeten mit Statistik umgehen konnte. Bei GSK war er dann unter anderem für Studien rund um die Einführung der HPV-Impfung zuständig. Im Jahr 2011 machte er sich selbstständig und gründete eine Firma, die Beratung im Bereich der Arzneimittelforschung anbietet. Ein Insider packt aus Dass die skandalösen Simpsonwood-Manuskripte an die Öffentlichkeit gelangt waren, war ein Betriebs unfall. Doch völlig überraschend blieb jeglicher öffentliche Aufschrei aus. In den Mainstream-Medien wurde kaum darüber berichtet, und selbst die wissenschaftliche Community hatte keine hörbaren Einwände oder Kommentare – nicht einmal, als die im Nachhinein veränderte und statistisch umgepolte Studie schließlich doch veröff entlicht wurde. Dass es damals innerhalb der CDC brodelte, erfuhr die staunende Öff entlichkeit erst in jüngster Vergangenheit. Und zwar über einen Kollegen von Tom Verstraeten, der als Chefepidemiologe und Statistiker viele Jahre lang zum Führungskern der CDC-Riege im Nationalen Impfprogramm gehört hatte: William Thompson. Im August 2014 wandte sich Thompson über das Anwaltsbü- ro Morgan Verkamp, das einen guten Ruf als Rechtsbeistand für Whistleblower genießt, mit einem schockierenden Statement an die Öff entlichkeit: Er gab zu, er und andere in der CDC hätten in ihren Studien betrogen, Daten unterschlagen und Resultate gefälscht, um Impfungen von dem Ruf freizuwaschen, sie könnten etwas mit der grassierenden Autismus-Epidemie zu tun haben. Thompson selbst hatte an mehreren Dutzend Arbeiten zur Sicherheit von Impfungen mitgearbeitet, darunter drei Studien, die einen Zusammenhang zwischen Impfungen und Autismus glatt widerlegten. Thompson, der zumindest auf dem Papier noch immer Angestellter der CDC ist, begründete seinen Schritt an die Öff entlichkeit mit seinem schlechtem Gewissen. In mehreren auf Band aufgezeichneten Gesprächen mit Brian Hooker, einem befreundeten Wissenschaftler, der selbst Vater eines autistischen Sohnes ist, legte er eine umfassende Beichte ab. Über die Konsequenzen sei er sich im Klaren, sagte Thompson, die werde er durchstehen. Doch er könne es nicht mehr länger verantworten zu schweigen: „Für mich bedeutet es nur, ein paar Monate durch die Hölle zu Der republikanische Kongressabgeordnete Bill Posey forderte am 29. Juli 2015 vor dem Kongress die Einsetzung eines Untersuchungsausschusses zur Prüfung der Vorwürfe, die Dr. Thompson gegen das CDC und seine Kollegen erhebt. Bis zum Redaktionsschluss war keine relevante Reaktion darauf festzustellen. – 14 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 gehen, wenn das jetzt alles öff entlich wird. Aber was ist das schon im Vergleich zu einer Familie, zu einem Kind, das tagein, tagaus leidet. So sehe ich das. Ich bin zutiefst beschämt, was ich getan habe.“ Im September 2015 veröff entlichte der Anwalt Kevin Barry ein Buch, das Thompsons komplette Aussagen zusammenfasst:8 Thompson gibt darin sich selbst und seinen Kolleginnen und Kollegen die Schuld, „mindestens zehn Jahre Forschung versäumt zu haben, ein Jahrzehnt, in dem die CDC wie gelähmt war und ihr Wissen nicht transparent gemacht hat.“ Thompson erzählt von der in internen Sitzungen ausgegebenen Parole, „dass wir niemals zugeben werden, dass Autismus eine tatsächliche Nebenwirkung von Impfungen ist“. Dass in diese Richtung keine öff entlichen Förderungsgelder ausbezahlt werden sollten, war sogar in offi ziellen Publikationen zu lesen, etwa des Institute of Medicine (IOM), dem obersten wissenschaftlichen Beratungsgremium der US-Politik.9 Das muss man sich einmal auf der Zunge zergehen lassen: Ein Land steht inmitten einer verheerenden Gesundheitskatastrophe, die hunderttausende Familien schwerstens belastet. Es erkranken reihenweise Babys, die ihr ganzes Leben lang spezielle Therapie und Pfl ege brauchen werden. Selbst Präsident Barack Obama erwähnte in einer Rede vor Medien, „dass wir, wenn die Autismuszahlen weiter so explodieren, niemals genug Geld haben werden, um diesen enormen Betreuungsaufwand leisten zu können“. Und die wissenschaftlichen Beraterinnen und Berater des Präsidenten schließen eine vorurteilsfreie Suche nach möglichen Ursachen der Katastrophe aus! Suche nach Ursachen – aber am falschen Ort Das beste Beispiel für diese Verdrängungstaktik liefert die CDC selbst mit ihrem SEED-Projekt, der „bislang größten amerikanischen Studie zur Erforschung von Risikofaktoren für Entwicklungsstörungen im Kindesalter“, wie die CDC-Webseite stolz ankündigt. Um die Öff entlichkeit über den Fortschritt der Studie zu informieren, veröff entlicht die Behörde halbjährlich Berichte. In der zuletzt erschienenen elften Ausgabe gibt es Informationen über die Wichtigkeit von Bewegung für die Gesundheit der Kinder, einen Bericht über einen autistischen Jugendlichen, der auf Konferenzen motivierende Vorträge hält und kürzlich sogar ein Buch veröff entlicht hat. Und schließlich News aus der wissenschaftlichen Praxis, in denen es um das Verständnis geht, welche Gene bei der Entstehung der verschiedenen Störungen des autistischen Spektrums beteiligt sein könnten. Und nun kommt William Thompson und berichtet, hinter diesen weitgehend nichtssagenden Texten für die Öff entlichkeit stehe „eine wahre Goldmine, ein Disneyland an Daten“. Daten wie „die Gesundheitsakten von rund 1.200 Kindern mit bestätigter Autismus-Diagnose inklusive allen Impfdaten der Kinder und sogar ihrer Eltern“. Gerade diese Akten werden aber bislang „unter Verschluss gehalten und weggesperrt“. Immerhin sei beabsichtigt, damit in Zukunft zu arbeiten, und laut Thompson gebe es auch schon rund 60 Forschungsanträge für Studien mit dem SEED-Datensatz. „Aber keine einzige davon befasst sich mit Impfungen, keine einzige.“ In dem aufgezeichneten Gespräch mit Brian Hooker ist Thompson anzumerken, wie sehr ihn diese Ignoranz empört: 1.200 Kinder mit Autismus, dazu eine Kontrollgruppe, alle Daten, die man sich nur wünschen kann, das wären sämtliche Zutaten zur Beantwortung der lange gesuchten Frage, ob Impfungen bei der Entstehung von Autismus eine Rolle spielen oder nicht. Er sei in der Behörde aktiv geworden und habe seine Kollegenschaft gelöchert, erzählt Thompson: „Wie werdet ihr euch rechtfertigen, niemals die Impfungen untersucht zu haben?“ Dass niemand diese „Hauptader der Goldmine“ mit ihm zusammen fördern und wissenschaftlich auswerten wollte, hat möglicherweise den Ausschlag dafür gegeben, dass der CDC-Mitarbeiter schließlich resignierte und keine andere Chance mehr sah, als einen Schlussstrich unter seine Karriere zu ziehen und sich an die Öff entlichkeit zu wenden. Studien als Propaganda-Material Bislang sind drei Impf-Inhaltsstoff e mit der Entstehung von Autismus in Verbindung gebracht worden: die Lebendviren aus der MMR-Impfung sowie die Metallverbindungen von Aluminium und Quecksilber (Thiomersal). Alle drei haben unterschiedliche Funktionen, unterschiedliche Wirkmechanismen und damit auch ein unterschiedliches Gefahrenpotenzial. Forschungsfragen gäbe es also wahrlich genug. In den USA und den meisten Entwicklungsländern sind nach wie vor thiomersal-haltige Impfstoff e auf dem Markt. In Europa wird Quecksilber als Konservierungsmittel nur noch „im Notfall“, wie es heißt, in Impfstoff en eingesetzt, zuletzt bei der Schweinegrippe-Pandemie. Dieses Buch des Anwalts Kevin Barry enthält die vier Telefongespräche zwischen Dr. William Thompson und Dr. Brian Hooker, die dieser mit Einverständnis Thompsons aufgezeichnet hatte. Es kann u. a. über Amazon bestellt werden. Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 15 – impf-report Nr. 109 4. Quartal 2015 Thompson erzählt von Experimenten mit Ratten, die gezeigt haben, dass die Tiere ein deutlich höheres Sterberisiko hatten, wenn die Dosierungen leicht erhöht wurden. Wer sich in den USA gegen Infl uenza impfen lässt, bekommt automatisch eine Dosis Quecksilber ab. „Ich weiß nicht, warum sie das immer noch für schwangere Frauen empfehlen“, empört sich der Whistleblower. „Das ist die letzte Personengruppe, der ich Quecksilber spritzen würde.“ An Studien zum Zusammenhang von MMR und Autismus war Thompson persönlich beteiligt. Diese Studien, erklärt er, waren gedacht als Antwort auf die Wake- fi eld-Diskussion und den Vertrauensverlust in die Sicherheit der Impfungen. Dummerweise ergab sich bei der Auswertung ein signifi kant höheres Autismusrisiko für Jungen afroamerikanischer Herkunft, die – entsprechend dem offi ziellen Impfplan – im Alter unter drei Jahren gegen Masern, Mumps und Röteln geimpft wurden. „Das war ein Resultat, das wir nicht erwartet hatten, und es wurde endlos darüber diskutiert, wie wir das wieder loswerden.“ Schließlich, erklärt Thompson, hätten sie eine Gruppe von Teilnehmern und deren Daten einfach aus dem Protokoll gestrichen – womit das Ergebnis nicht mehr auff ällig war. „Ich war Komplize“, gesteht Thompson zerknirscht. „Wir haben niemandem von den signifi kanten Resultaten erzählt. Wenn ich jetzt Familien mit autistischen Kindern treff e, dann fühle ich eine riesengroße Scham. Denn ich habe möglicherweise dazu beigetragen.“ Das Vertuschungskomplott Das Vorwort zu dem Buch, das vorerst nur auf Englisch erhältlich ist, stammt von Boyd E. Haley, einem Professor für Chemie an der Universität von Kentucky, der als Experte für die Toxikologie von Inhaltsstoff en der Impfstoff e gilt. Er appelliert an jeden Kinderarzt, jede Kinderärztin, dieses Buch zu lesen, um gemeinsam eine medizinische Untersuchung einzuleiten. „Die Vorwürfe von Dr. Thompson sind so gravierend, dass die Frage der Sicherheit von Impfungen vollständig neu geprüft werden muss.“ Der Anwalt und Autor Robert F. Kennedy Jr. – der Neff e des ermordeten Präsidenten JFK – unterstützt diese Forderung in einem weiteren Vorwort und greift auch scharf die US-Medien an, bislang zu den Vorgängen um die CDC weitgehend geschwiegen zu haben: „Die Reporter plappern die Sprechblasen, die ihnen von korrupten Gesundheitsbeamten und Sprechern der Impfstoffi ndustrie hingeworfen werden, kritiklos nach wie Papageien.“ Dies sei wohl nur damit zu erklären, dass sich die Medienkonzerne als Komplizen der pharmazeutischen Industrie sehen, von deren Anzeigen sie fi nanziell abhängig seien. Besonders bildlich wird Thompsons Bericht, wo es um die Vertuschung des ganzen Skandals geht. „Die Autoren der Studie vereinbarten einen Termin, an dem alle Dokumente im Zusammenhang mit der Studie zerstört werden sollten. Wir waren zu viert und einer brachte in den Konferenzraum einen riesigen Müllsack mit. Dann gingen wir alle Dokumente durch und entschieden, welche wir entsorgen wollten. Das geschah auch. Allerdings hatte ich damals schon Bedenken, dass das illegal ist, was wir hier tun. Und ich behielt von allen Dokumenten Kopien in meinem Büro. Sowohl in Papier als auch am Computer.“ Diese Aussage Thompsons verlas der republikanische Kongressabgeordnete aus Florida, Bill Posey, am 29. Juli 2015 im US-Repräsentantenhaus. Thompson hatte Posey als Abgeordneten seines Vertrauens mehr als 100.000 Seiten der brisanten CDC-Unterlagen zukommen lassen. Posey erklärte in seiner Rede, dass er dazu beitragen wolle, diesen Skandal aufzuklären. Wer immer möchte – seien es Politikerkolleginnen und -kollegen oder Leute aus den Medien – bräuchten nur in seinem Büro anzurufen und könnten Kopien von Thompsons Unterlagen erhalten. Der Applaus auf die Rede war schwach. Bis Redaktionsschluss dieses Buches hat weder jemand aus der Politik noch aus den großen Medienhäusern das Angebot wahrgenommen. Einfl uss auf die Politik Seit dem Jahr 1998 ist die pharmazeutische Industrie zur mit Abstand größten Sponsorin der beiden großen politischen Parteien der USA aufgestiegen. In diesem Zeitraum wurden insgesamt 3,15 Milliarden US-Dollar offi ziell als Ausgaben für politisches Lobbying verbucht. Bei den Zuwendungen an die Parteien hat sich im Laufe der letzten Jahre ein interessanter Wandel vollzogen: Während im Jahr 2000 nur 36 Prozent der Gelder an die demokratische Partei gingen und 2004 sogar nur 31 Prozent, brachte der Wahlkampf von Barack Obama im Jahr 2008 den Umschwung. Von den 20 Millionen US-Dollar, die offi ziell an die Kandidaten gespendet wurden, waren nun beide Parteien etwa in gleichem Umfang bedacht. Barack Obama erhielt mit 848.000 US-Dollar die mit Abstand höchsten Zuwendungen als Einzelperson. Die beiden größten Impfstoff – hersteller der USA, Merck und Pfi zer, gaben im Jahr 2014 jeweils mehr als acht Millionen US-Dollar für politisches Lobbying aus und stehen damit an der Spitze aller Branchen – weit vor Öl- oder Rü- stungsfi rmen oder den großen Versicherungsunternehmen. „Ich bin davon überzeugt, dass die Zerstörung der Karriere Ihres Mannes ungerechtfertigt ist und dass diese Studie seine wissenschaftliche Meinung unterstützt hätte. Ich hoffe, ich kann dabei helfen, dies wiedergutzumachen.“ Dr. William Thompson zu Andrew Wakefi elds Ehefrau Carmel Quelle: „Vaccine Whistleblower“, S. 142 – 16 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Das unkontrollierte System Als bislang beste und eindeutige Belege, dass Impfungen nichts mit Autismus zu tun haben, werden häufi g Studien aus Dänemark genannt, an denen Poul Thorsen, Professor an der Universität von Aarhus, mitgearbeitet hatte. Drei dieser Aarhus-Studien wurden 2004 in der abschließenden Beurteilung des Institute of Medicine ausdrücklich genannt als Belege für die Beurteilung, „dass die vorhandene Evidenz eine Zurückweisung des Zusammenhangs zwischen Impfungen und der Entstehung von Autismus favorisiert“. Zur Glaubwürdigkeit dieser Studien trug natürlich auch bei, dass es sich dabei um unabhängige Arbeiten handelte, die außerhalb der USA in einem skandinavischen Land mit allseits bekannten hohen wissenschaftlichen Standards durchgeführt worden waren. Nur wer die kleingedruckten Hinweise am Ende der Studien unter die Lupe nimmt, sieht, dass sie von der CDC fi nanziert wurden.10,11 Die dänischen Studien wurden wegen ihres mangelhaften Designs heftig kritisiert. Und was der Angelegenheit einen beinahe tragisch-komischen Anstrich gibt, ist die Beziehung der CDC zu ihrem Verbindungsmann im dänischen Forschungsteam, Poul Thorsen: Seit einigen Jahren steht der nämlich auf Betreiben der Gesundheitsbehörde auf einer internationalen Fahndungsliste der USA als „gesuchter Flüchtiger“.12 Thorsen habe mehr als eine Million US-Dollar aus Forschungsgeldern der CDC unterschlagen und auf sein persönliches Bankkonto überwiesen. Mit dem Geld habe er sich ein Haus gekauft, eine Harley Davidson, einen Audi sowie einen Honda SUV. Die Anträge an die dänischen Behörden seien übermittelt, heißt es in dem Steckbrief und Thorsen erwarte die Auslieferung an die USA. Dass es sich beim dänischen CDC-Kontaktmann also off ensichtlich um einen Betrüger handelt, ist eine der ironischen Fußnoten dieser Aff äre. Doch was ist anderes zu erwarten, wenn im eigenen Betrieb derart straff e Vorgaben herrschen, welche Resultate von den eigenen klinischen Studien erwartet werden? Möglicherweise wirken solche Signale ja auch außerhalb der künstlichen Realität der selbst gebastelten CDC-Wissenschaft anziehend auf Menschen, die es mit Ehrlichkeit nicht allzu genau nehmen. Julie Gerberding, die Langzeit-Direktorin der CDC, in deren Amtszeit die meisten der von Thompson beschriebenen Aff ären fallen, verließ die Gesundheitsbehörde im Jahr 2009. Was denken Sie, was die Frau nun berufl ich macht? Sie wechselte umgehend zum Konzern Merck, in dem sie jetzt die Impfstoff abteilung leitet. Es klingt wie eine Folge „House of Cards“, jener Serie, die so desillusionierend über die Abgründe der Politik berichtet. Doch diese Wie der frühere Präsident des Weltautistmusverbandes (WAO) in einem Interview berichtet, wirkt sich der Maulkorb der Hersteller selbst auf Patientenverbände aus. Erst nach seinem Ausscheiden sah er sich in der Lage, off en über Hinweise auf einen Zusammenhang mit Impfungen zu sprechen. Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 17 – impf-report Nr. 109 4. Quartal 2015 Geschichten sind nicht erfunden. Wieder und wieder belegen sie die sozusagen hautengen Beziehungen zwischen Big Pharma und Behörden. Das sei seine ganze Berufslaufbahn über so gewesen, erzählt Thompson in seinen „Geständnissen“. Gute Beziehungen zu den Impfstoff herstellern galten immer als oberste Prämisse. „Wenn sich jemand negativ über die Industrie äußerte, wurde das von der Leitung der Behörde sehr feindlich aufgenommen.“ Für uns Normalsterbliche ist diese Form der Hörigkeit natürlich ein Desaster: Unsere Gesellschaft hat diese Instanzen eigens dafür eingerichtet und fi nanziert, um die bestmögliche Gesundheit der Bevölkerung zu gewährleisten. Und die üben ihre Kontrollfunktion nicht aus. Sei es, weil ihre führenden Kader durch und durch korrupt sind, sei es, weil „nicht sein kann, was nicht sein darf“ – im Prinzip führt es auf dasselbe hinaus: die Unfähigkeit, ein aktuelles Problem zu erkennen, Ursachen vorurteilsfrei aufzuklären und einer bestmöglichen Lösung zuzuführen. Die Situation in Europa Wer nun denkt, dass es sich bei den Zuständen in der CDC um Eigenheiten der USA handelt, die nicht auf die Arzneimittel- und Gesundheitsbehörden in der Europäischen Union übertragbar sind, ist naiv. Auch bei der European Medical Agency (EMA) in London, die für die Beurteilung und Überwachung der Arzneimittel in der EU zuständig ist, gehen Lobbyisten ein und aus. Allzu oft wird eine Expertise aus den USA einfach übernommen oder sogar als Basis der eigenen Entscheidungen ausgegeben. Das färbt auch auf die Behörden in den einzelnen Mitgliedsstaaten ab. Klaus Hartmann, der zehn Jahre beim Paul-Ehrlich-Institut im hessischen Langen tätig war, also bei jener Behörde, welche die Sicherheit von Impfungen in Deutschland überwacht, erzählte mir viel über die internen Vorgänge und die Tendenz, die nationalen Behörden von London aus immer mehr an die Kandare zu nehmen und deren Entscheidungen zu beeinfl ussen. Hartmann hatte Anfang der 2000er-Jahre beispielsweise eine Untersuchung zur Sicherheit des gerade neu eingeführten 6-fach-Impfstoff s Hexavac eingeleitet, weil mehrere Fälle von plötzlichem Kindstod in nahem zeitlichen Zusammenhang mit den Impfterminen aufgetreten waren. Nach einer Prüfung von wenigen Wochen erklärte die EMA Hartmanns Bedenken jedoch für haltlos und gab Hexavac wieder frei. Hartmanns Vorgesetzte beugten sich ohne weiteres der Einschätzung der EMA und erklärten ihm, er solle diese Angelegenheit als abgeschlossen betrachten. „Derartige Vorfälle haben es mir unmöglich gemacht, eine Fortführung meiner Arbeit im Paul-Ehrlich-Institut mit meinem Gewissen zu vereinbaren“, erzählte mir Hartmann. Er kündigte seinen Job und arbeitet heute als Arbeitsmediziner in Wiesbaden. Sanofi Pasteur, die Hersteller- fi rma von Hexavac, nahm wenig später ihren Bestseller übrigens unter einem Vorwand vom Markt. Patientenvertreter mit Interessenskonfl ikt Und was ist mit den Autismusverbänden? Jenen großen Organisationen, die vorgeben, nichts anderes im Sinn zu haben, als Licht ins Dunkel dieser Krankheit zu bringen? Was ist mit Organisationen wie die World Autism Organisation (WAO), eine 1998 gegründete Vereinigung, die weltweit Kongresse organisiert und Forschung fördert, „welche die Lebensqualität von Menschen mit Autismus und ihrer Familien verbessert“? Der langjährige Präsident der WAO, Paul Shattock, war mehr als 40 Jahre in der Autismusforschung tätig, unter anderem als Direktor der Autism Research Unit der Universität von Sunderland in England. Shattock sieht aus wie ein typischer englischer Gentleman. Er hat einen trockenen Humor und einen sehr persönlichen Zugang zum Thema: Sein Sohn Jamie wurde 1975 im Alter von vier Jahren mit Autismus diagnostiziert – damals das jüngste Kind in Nordengland mit dieser Diagnose. Heute ist Jamie Mitte vierzig und lebt noch immer bei seinen Eltern. Auch Jamie hat besondere Talente: „Er kennt jedes Geschäft mit Süßigkeiten, und verliert man im Supermarkt den Einkaufswagen, weiß Jamie immer genau, wo er steht“, erzählt Paul Shattock. „Deshalb verlieren wir den Wagen immer absichtlich – damit er ihn fi nden kann.“ Shattock lächelt, und man merkt ihm an, dass er diese Geschichte schon sehr oft erzählt hat. Als ihn die deutsche Filmemacherin Natalie Beer Anfang 2015 zu einem Interview in Sunderland traf, hatte er gerade seinen Job als Präsident der WAO an eine Nachfolgerin aus Südafrika übergeben. „Damit kann ich nun Dinge sagen, die ich zuvor nicht sagen konnte, weil wir da immer Rücksicht nehmen mussten, unsere Förderer und Gesprächspartner aus Politik und Wirtschaft nur ja nicht mit kontroversen Themen zu irritieren“, bekannte der Ex-Präsident.13 Doch nun fühle er sich daran nicht mehr gebunden. Und so erzählt er der Filmemacherin frank und frei, dass er lange Zeit der Meinung war, dass Impfungen nichts mit der Störung zu tun hätten. „Ich war so arrogant, wie man nur sein kann. Ich verschob die Fakten so lange, bis sie in die Theorie passten, so wie es auch alle anderen machten.“ Bis ihm schließlich durch fortwährende Hinweise von Eltern und auch einzelner Kollegen klar wurde: „Oh shit, die Mütter erzählen die Wahrheit.“ Heute ist Shattock überzeugt, dass Impfungen sehr wohl ein Trigger der Entwicklungsstörung seien und diese zum Ausbruch bringen können. Dass Autismus in den USA so ungleich häufi ger auftritt, führt er unter anderem auf die im Vergleich zu Europa noch deutlich dichteren Impfpläne zurück. „Die Hepatitis-B-Impfung wird dort gleich am ersten Lebenstag gegeben, oft bereits eine Stunde nach der Geburt. Zu diesem Zeitpunkt ist das Immunsystem vollständig unreif und funktioniert noch gar nicht richtig.“ – 18 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Natalie Beer fragte, warum in diese Richtung nicht mehr geforscht werde und warum es zum Thema Impfungen keine kritischen Studienansätze gebe. „Wohl vor allem deshalb, weil die Leute Angst haben, was sie fi nden könnten“, antwortet Paul Shattock mit entwaff nender Off enheit. „Jeder andere Risikofaktor wäre längst untersucht worden. Aber weil es sich um Impfungen handelt, schrecken alle zurück: ‚Das ist heilig, und es ist uns in keiner Weise erlaubt, das Vertrauen der Menschen in Impfungen aufs Spiel zu setzen.‘ So denken die Leute, und so läuft das ab.“ Fußnoten: 1 Godlee F: „Wakefi eld’s article linking MMR vaccine and autism was fraudulent“, BMJ 2011; 342:c7452 2 Andrew J. Wakefi eld: „Waging war on the autistic child“. Skyhorse Publishing, 2012 3 Das Interview mit Andrew Wakefi eld führte der US-Journalist Alex Jones. Infowars, 17. 1. 2013 4 Libbey JE et al.: „Autistic disorder and viral infection“, J Neurovirol 2005; 11(1): S. 1–10 5 Scientifi c review of vaccine safety datalink information, Simpsonwood Transcript, June 2000 6 Bei dieser Organisation handelt es sich um „safeMinds“, eine USA-weite Initiative von Eltern Autismus-kranker Kinder. Auf deren Webseite http://www.safeminds. org fi ndet sich auch ein Link zum Download der Dokumente rund um das Simpsonwood-Meeting. 7 Verstraeten T et al.: „Safety of thimerosal-containing vaccines: a two-phased study of computerized health maintenance organization databases“, Pediatrics 2003; 112: S. 1039–48 8 Kevin Barry: „Vaccine Whistleblower: Exposing Autism Research Fraud at the CDC“. Skyhorse Publishing, 2015 9 „Immunization Safety Review: Vaccines and Autism“, Institute of Medicine, 14. 5. 2004 10 Madsen KM et al.: „A population based study of measles mumps and rubella vaccination and autism“, NEJM 2002; 347: S. 1477– 82 11 Madsen KM et al.: „Thimerosal and the occurrence of autism: negative ecological evidence from danish population-based data“, Pediatrics 2003; 112: S. 604ff 12 https://oig.hhs.gov/fraud/fugitives/profi les.asp 13 Während ich diese Zeilen schreibe – im August 2015 –, ist Natalie Beers interessanter Dokumentar- fi lm zur Impfdebatte noch nicht veröff entlicht worden. Noch ist nicht klar, ob sich eine TV-Station traut, den Film ins Programm zu nehmen, ob es einen regulären Kinostart gibt, oder ob der Film ausschließlich auf Festivals und in Programmkinos gezeigt werden kann. Auf DVD wird er jedenfalls erhältlich sein. Ich bedanke mich bei Natalie herzlich für das Vertrauen, mir den Film vorab gezeigt und dieser Veröff entlichung zugestimmt zu haben. Der vorstehende Artikel des österreichischen Medizinjournalisten Bert Ehgartner ist nur ein kleiner Auszug aus seinem neuesten Buch „Die Hygienefalle“, den wir dankenswerterweise vorab abdrucken durften. Wie der Titel schon andeutet, geht es in dem Buch in erster Linie um die allgemeine Erreger-Phobie: Das stärkste Marketing-Argument der Hersteller und ihrer Parteigänger ist schließlich die systematische Schürung einer regelrechten Mikroben-Paranoia in der Bevölkerung. Nur aufgrund unserer irrationalen Ängste vor Erregern war und ist es möglich, dass wir die Verimpfung von Produkten in die Körper unserer Kinder zulassen, deren Notwendigkeit, Wirksamkeit und Sicherheit durchaus diskussionswürdig sind. Bert Ehgartner räumt in seinem Buch gründlich mit dem Aberglauben auf, Bakterien und Viren seien grundsätzlich böse – und wir ihnen hilfl os ausgeliefert. Dem ist nicht so. Der Autor Buchbesprechung „Die Hygienefalle“ von Bert Ehgartner von Hans U. P. Tolzin führt zahlreiche Beispiele dafür an, dass die sogenannten Erreger sogar bei der Schulung unseres Immunsystems eine wichtige Rolle spielen – und darüber hinaus ihre Gene durchaus nützlich sein können. Die Erreger sind darüber hinaus in der Regel gar nicht allein in der Lage, Krankheiten zu erzeugen. Vielmehr muss dafür bereits im Vorfeld eine Schwächung des Organismus vorliegen. Die gegenwärtige Erregerphobie ist, wie der Autor zeigt, keineswegs eine Erfi ndung des aktuellen Jahrhunderts. Vielmehr begann sie Ende des 19. Jahrhunderts mit den Pionieren der Infektionshypothese, also mit Louis Pasteur, Robert Koch, Emil von Behring und Paul Ehrlich. Systematisch wird seither von den Bakterien- und Virenjägern jeder Hinweis ignoriert, der die Rolle der Erreger als allgegenwärtige Dämonen relativiert oder gar widerspricht. Wie Ehgartner anhand konkreter Beispiele aufzeigt, scheint Bert Ehgartner DIE HYGIENEFALLE Schluss mit dem Krieg gegen Viren und Bakterien Broschürt 260 Seiten Preis: 19,90 € Unsere Bestell-Nr.: FBU-118 Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 19 – impf-report Nr. 109 4. Quartal 2015 die Pharmaindustrie nicht nur die Wissenschaft, sondern auch die Politik und die Medien fest in ihrer Hand zu haben. Dafür werden jährlich Milliarden Euro in die Forschung und die Lobbyarbeit gepumpt. Dieses Buch stellt einen Durchbruch dar – ist es doch meines Wissens das erste populärwissenschaftliche Sachbuch zu diesem Thema, das vor allem für den „Otto Normalverbraucher“ geschrieben wurde, der sich bisher noch keine Gedanken zu diesem Thema Erfundene Polio-Gefahren für besseren Impfstoff-Verkauf „Der Himmel fällt uns auf den Kopf! Der Himmel fällt uns auf den Kopf!“ Wann immer es um Epidemien von Infektionskrankheiten geht, können Sie in Einem sicher sein: Die Weltgesundheitsorganisation (WHO) schlägt Alarm, ob es gerechtfertigt ist oder nicht. Ein Paradebeispiel ist die Erklärung der WHO im Mai 2014, wonach Polio eine „Public Health Emergency of International Concern“ (PHEIC, Gesundheitliche Notlage von internationaler Tragweite) darstellt.1 von Mike Adams, naturalnews.com am 20. Mai 2014 Übersetzung: Kopp Verlag, info.kopp-online.de Eine solche Notlage beschreibt die WHO offi ziell als „ein außergewöhnliches Ereignis, das durch die internationale Verbreitung der Krankheit ein Risiko für die öff entliche Gesundheit anderer Länder darstellt und möglicherweise eine koordinierte internationale Reaktion erfordert“. Und was ist dieses „außergewöhnliche Ereignis“, über das wir alle besorgt sein sollten und das die Mainstreammedien gehorsam als „globale gesundheitliche Notlage“ darstellen? Die Antwort lautet: 68 Fälle von Polio weltweit. Und von diesen 68 Poliofällen sind 59 in Pakistan aufgetreten.2 Mit anderen Worten: Wenn Sie nicht in Pakistan leben – und das tun die meisten Menschen nun einmal nicht –, liegt die Gefahr, dass Sie sich bisher in diesem Jahr an der Kinderlähmung angesteckt haben, bei ungefähr eins zu einer Milliarde. Wenn Sie in den USA leben, ist Ihr Risiko exakt NULL, denn seit 1979 hat es dort keinen Fall von Polio mehr gegeben (Was, über dieses medizinische Faktum haben Sie in den Abendnachrichten nichts gehört?). Wie wird dann aus einem Poliorisiko von eins zu einer Milliarde ein „außergewöhnliches Ereignis“, das ein weltweites Gesundheitsrisiko darstellt? Ganz einfach: Es gibt kein solches Risiko. Es sei denn, Sie sind eine Quacksalberwissenschafts-Gesundheitsorganisation, die versucht, auf der ganzen Welt die Menschen so in Angst und Schrecken zu versetzen, dass sie Polio-Impfstoff e kaufen. Und genau darin ist die WHO am besten: Falsche Pandemien auszurufen, um Regierungen dazu zu bringen, Impfstoff e einzulagern, die sie nie verwenden werden. Erinnern Sie sich noch an die SchweinegrippePandemie von 2009, als die WHO die Pandemiephase sechs ausrief? Wie wir heute wissen, bestanden bei den meisten Mitgliedern des WHO-Beirats fi nanzielle Verbindungen zu Impfstoff -Herstellern.3 Weltweit kauften Regierungen tonnenweise den Impfstoff gegen die Schweinegrippe, nur um dann später noch mehr dafür zu bezahlen, ihn wieder entsorgen zu lassen, nachdem er nicht benötigt wurde. Globale Pandemie bei einem Risiko von 1 : 1 Milliarde? Wenn die Mainstream-Medien mit dem Begriff „globale Pandemie“ um sich werfen, entstehen vor dem inneren Auge Bilder von weltweitem Massensterben mit Millionen von Leichensäcken und katastrophalen Ansteckungsraten. Aber die eher faktische Realität von fast null Infektionen in allen Ländern der Welt – ausgenommen ein einziges Land – ist keine gute Propaganda für Impfstoff e, also berichtet die Presse nie über die reale Lage: „Hey, Amerikaner! Bei euch besteht ein eine Million Mal hö- heres Risiko, von einem Medikament umgebracht zu werden, als sich an Polio anzustecken!“ Bedenken Sie, dass Jahr für Jahr 80.000 Amerikaner wegen einer Acetaminophen- (in Deutschgemacht hat. Es sollte im Bücherregal aller Eltern stehen, die sich mit der Frage auseinandersetzen, welche Risiken Infektionskrankheiten tatsächlich für ihre Kinder darstellen und was sie als Vorsorge tun können. Die Frage, die auch Ehgartner aufwirft, ist natürlich, wie man künftig z. B. bei den Masern die Vorteile einer natürlichen oder quasi-natürlichen Durchseuchung und der damit einhergehenden dauerhaften Immunität in der Bevölkerung ausschöpfen kann, ohne die Nachteile der derzeitigen Impfstoff e in Kauf nehmen zu müssen. Damit Behörden und Politik endlich in eine industrieunabhängige Richtung einschwenken, ist jedoch laut Ehgartner zunächst eine „Revolution von unten“ im Sinne eines allgemeinen Umdenkens erforderlich. Bert Ehgartners Buch leistet dafür meiner Ansicht nach einen entscheidenden Beitrag. Darum sollte es in keinem Bücherregal – 20 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 land als PARACETAMOL bekannt) Vergiftung in die Notaufnahme von Krankenhäusern gebracht werden, weil sie zu viel von dem Schmerzmittel Tylenol eingenommen haben. Ungefähr 500 sterben jedes Jahr, doch für die WHO ist das kein „außergewöhnliches Ereignis“. 4 Laut wissenschaftlichen Untersuchungen, die im New England Journal of Medicine veröff entlicht wurden, sterben jedes Jahr mindestens 16.500 Amerikaner an NSAID-(Nichtsteroidale Entzündungshemmer) Schmerzmitteln. Auch das bedeutet für die WHO keine „gesundheitliche Notlage von internationaler Tragweite“.5 98.000 Kinder, eine erstaunlich hohe Zahl, verletzen sich alljährlich beim Trampolinspringen. Doch die WHO hat Trampoline bisher nicht zur „gesundheitlichen Notlage“ erklärt. Vielleicht, weil es keine „Trampolin-Impfstoff e“ gibt, die man der Öff entlichkeit verkaufen könnte.6 In Swimmingpools ertrinken jedes Jahr allein in den USA ungefähr 3.900 Menschen, wie die Gesundheitsbehörde CDC (Centers for Disease Control and Prevention) mitteilt. Doch auch diese Todesfälle werden von der WHO nicht zum „außergewöhnlichen Ereignis“ erklärt. Auch hier gilt: Es gibt keinen Impfstoff gegen Ertrinken.7 Wagen wir einen Blick auf die Autounfälle? In den USA sterben jedes Jahr 25.000 Menschen beim Autofahren. Die Zahl der Opfer stellt alle Poliofälle weltweit um Größenordnungen in den Schatten. Dennoch hat die WHO das Autofahren noch nie zur „gesundheitlichen Notlage von weltweiter Tragweite“ erklärt. Könnte auch das daran liegen, dass keine Impfstoff e verkauft werden, die Menschen immun gegen Autounfälle machen?8 Pandemie, sobald Geld damit verdient wird Wenn Sie die reale Story hinter der korrupten, wissenschaftsfeindlichen WHO betrachten, zeigt sich ein ganz bestimmtes Muster: Nichts wird zu einer globalen Pandemie oder zum Gesundheitsnotstand erklärt, womit nicht genügend Geld gemacht wird. Die WHO ist vollkommen von pharmazeutischen Interessen beherrscht und wird als Waff e der Angst und Kontrolle über die Menschen auf der Welt eingesetzt, um sie dazu zu bewegen, Medikamente zu kaufen, die sie fast nie wirklich brauchen. Raten Sie mal, was man Ihnen bei all dieser Angstmache und Panik – „Der Himmel fällt uns auf den Kopf!“ – nicht erzählt? Dass es in den Vereinigten Staaten von Amerika seit 1979 keinen einzigen Fall von Polio gegeben hat. Jawohl, seit 35 Jahren hat es in Amerika keine Kinderlähmung mehr gegeben. Laut CDC, Mainstream-Medien und allen Impfstoff -Herstellern ist dies einzig und allein darauf zurückzuführen, dass Polio-Impfstoff e die Krankheit in Amerika ausgerottet haben. Deshalb sollte sich jeder weiter gegen Polio impfen lassen. Jeder, dessen Gehirn einigermaßen funktioniert, sollte den Fehler in dieser Logik sofort erkennen: Wenn Polio eine Infektionskrankheit ist, und wenn niemand in den USA daran leidet, mit welcher Begründung sollte dann jedes Kind in Amerika dagegen geimpft werden? Polio ist also verschwunden, aber Sie sollten sich trotzdem dagegen impfen lassen, obwohl die Chance, dass Sie in Amerika mit Polio auch nur in Kontakt kommen, praktisch null ist. Zusätzlich zu diesem medizinischen Schwindel, den CDC und WHO betreiben, geben die Gesundheitsbehörden nicht zu, dass 98 Millionen Amerikanern Polio-Impfstoff e injiziert wurden, die krebsverursachende Viren enthielten. Tatsächlich haben die CDC dies früher eingeräumt, aber im letzten Jahr haben sie den Bericht von ihrer Website entfernt – eine Art „Umschreibung der Geschichte“, die nach Orwellscher Propaganda riecht. (CDC = Wahrheitsministerium für alles, was mit Krankheit zusammenhängt.) Jetzt lautet die offi zielle Story der CDC – so grotesk es auch klingen mag – wie folgt: * Polio ist in Amerika seit 35 Jahren besiegt, niemand hier leidet daran. * Doch da ein paar Dutzend Menschen in Pakistan daran erkrankt sind, KÖNNTEN SIE DIE KRANKHEIT AUCH BEKOMMEN! (Irgendwie, vielleicht durch Magie.) * Deshalb sollten alle Kinder in Amerika umgehend gegen Polio geimpft werden, als hinge ihr Leben davon ab, obwohl es in Wirklichkeit nicht so ist. * Dabei implizieren sie, es hätte nie Probleme mit Polio-Impfstoff en gegeben und sie hätten nie Krebs ausgelöst. Dass Polio-Impfstoff e Krebs verursachen, ist keine „offi zielle“ Geschichte mehr und deshalb nie passiert. Sie sollen glauben, Polio-Impfstoff e seien jetzt und in alle Ewigkeit sicher und Sie könnten ihnen vertrauen. Und die würden Sie doch niemals anlügen, oder? Ach ja, und kümmern Sie sich nicht darum, dass Polio-Impfstoff e überall in Indien bei Kindern Lähmungssymptome verursachen, höchstwahrscheinlich wegen der gefährlichen Toxine und Schwermetalle, die üblicherweise in Impfstoff en enthalten sind. Impfstoff -Quacksalberei Um es klar zu sagen: Ich bin kein Gegner der Idee der Immunisierung, und ich bin nicht gegen Einzelimpfstoff e, die ohne giftige Wirkverstärker, Schwermetalle und versteckte Krebsviren formuliert sind. Ich bin allerdings gegen diese Art purer Impfstoff -Quacksalberei, die WHO und CDC praktizieren, die gerade beide auf frischer Tat dabei ertappt wurden, wie sie einige wenige örtliche Infektionen übertrieben als Schauergeschichte über eine globale Pandemie darstellten, um mehr Impfstoff e zu verkaufen. Sowohl die CDC als auch die WHO werden von Menschen geleitet, die off en gesagt organisierter Kriminalität schuldig sind, indem sie ihren Einfl uss nutzen, um die Öff entlichkeit zu beschwindeln, anstatt akkurate, nüchterne Informationen über echte Gesundheitsrisiken zu liefern. Heute funktionieren CDC und WHO kaum anders als durch Konzerne Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 21 – impf-report Nr. 109 4. Quartal 2015 kontrollierte Frontgruppen für Impfstoff e, die jeden Rest ihrer früheren wissenschaftlichen Glaubwürdigkeit zerstört haben. Aus glaubwürdigen, integren und wissenschaftsbasierten Organisationen wurde der Junge, der ständig „Der böse Wolf“ schreit, um mehr Impfstoff e zu verkaufen, die keiner braucht. Und dadurch stumpfen sie die Öff entlichkeit ab gegen zukünftige Warnungen über wirkliche Ausbrüche globaler Pandemien, die auftreten und eine echte Bedrohung darstellen können. Leider können wir heute nichts mehr von dem glauben, was die WHO oder die CDC über Infektionskrankheiten sagen, weil wir jetzt feststellen müssen, dass all ihre Äußerungen von Konzernprofi ten und nicht von der Sorge um die allgemeine Gesundheit motiviert sind. Läge diesen Organisationen wirklich die allgemeine Gesundheit am Herzen, würden sie sich auf vier vernünftige Aktionen konzentrieren: 1) Die Forderung, alle giftigen Schwermetalle (Quecksilber) und neurotoxischen Inhaltsstoff e aus Impfstoff en zu entfernen, darunter Formaldehyd, MSG [Mononatriumglutamat, Anm. d. Red.] und Aluminium. 2) Die Bevölkerung dazu anhalten, die eigenen Abwehrkräfte zu stärken, und zwar durch einen gesunden Lebensstil, wie die Einnahme von Vitamin-D-Ergänzungsmitteln, den Verzehr von mehr frischem Obst und Gemüse und weniger Kontakt mit immunsuppressiven Umweltgiften wie Pestiziden, Acrylamiden und chemischen Lebensmittelzusätzen. 3) Damit aufhören, einige wenige lokale Infektionen zu übertreiben und sensationshungrig zu globalen Kampagnen „medizinischer Angstmache“ umzufunktionieren. Anstatt jeden in Angst und Schrecken zu versetzen, damit er mehr Impfstoff e kauft, sollten rationale wöchentliche Aktualisierungen mit wissenschaftlich bestä- tigten Risikoeinschätzungen veröff entlicht werden, die das Risiko einer Ansteckung mit Polio, MERS, Schweinegrippe oder jeder anderen Seuche, über die das System besorgt ist, zutreff end beschreibt. Und au- ßerdem: 4) Nicht mehr fälschlich zu behaupten, dass Impfstoff e null Risiko bedeuten. Bei allen medizinischen Eingriff en – auch bei Impfstoff en – muss eine wissenschaftliche Risiko-Nutzen-Einschätzung vorgenommen werden. Das falsche Paradigma der Impfstoff -Industrie besagt, Impfstoff e seien 100 Prozent sicher bei null Prozent Risiko. Das ist schlicht falsch und medizinisch fahrlässig. Alle Impfstoff e bergen ein gewisses Risiko ernster Nebenwirkungen, einschließlich Lähmung und sogar Tod. Dieses Risiko mag für den Einzelnen klein erscheinen, aber wenn das CDC off en die Massenimpfung von über 300 Millionen Amerikanern gegen eine Krankheit propagiert, die in diesem Land nicht einmal existiert, dann besteht ein erhebliches Gesamtrisiko tödlicher Nebenwirkungen, das nicht durch die Art von Quacksalberwissenschafts-Taschenspielertricks vom Tisch gefegt werden kann, wie es das CDC heute praktiziert. Jeder, der behauptet, Impfstoff e bedeuteten null Risiko, ist ein Lügner. Alle Impfstoff e bergen das Risiko von Nebenwirkungen und sogar Tod. Jeder, der behauptet, alle Amerikaner müssten sich gegen eine Krankheit impfen lassen, die seit über 30 Jahren in den Vereinigten Staaten nicht mehr aufgetreten ist, sollte seinen Kopf untersuchen lassen. Die eigene Glaubwürdigkeit zerstört Wenn das gesamte System der Immunisierungs-Propaganda darauf beruht, dass das medizinische Risiko rundherum geleugnet und gleichzeitig irrelevante lokale Ereignisse zu „globalen Gesundheitsrisiken von internationaler Tragweite“ aufgeblasen werden, dann macht sich das System nur zum Gespött echter wissenschaftlicher Denker. Ich möchte gern einen Weg fi nden, die CDC und die WHO zu respektieren, aber dazu wird es nur kommen, wenn diese beiden Organisationen anfangen, integre Wissenschaft im öff entlichen Interesse zu praktizieren und keine Impfstoff -Quacksalberei gekoppelt mit schamloser Konzern-Propaganda betreiben. Die einfache Wahrheit ist, dass 59 Menschen in Pakistan keinen „Gesundheitsnotstand von internationaler Tragweite“ darstellen. Der echte globale Gesundheitsnotstand ist die medizinische Unfä- higkeit von WHO und CDC – zwei Organisationen, die Hand in Hand arbeiten, um Angst, Verwirrung und Vernebelung über die wahren Risiken von Infektionskrankheiten und ihre mögliche Behandlung zu erzeugen. Falls Sie einen Besuch auf einer Polio-Krankenstation in Pakistan planen, sollten Sie sich tatsächlich vorher impfen lassen. Aber abgesehen von solch exotischen Reiseabsichten ist Ihr Risiko, sich mit Polio zu infi zieren, medizinisch gesehen praktisch null. Fußnoten: 1 „Frequently asked questions on IHR Emergency Commitee“, WHO online, abgerufen am 13. Okt. 2015 2 „Global emergency declared as polio cases surge“, New scientist online vom 5. Mai 2014 3 „WHO list reveals fl u advisors with fi nancial ties to pharma, vaccine manufacturers“, naturalnews.com vom 11. Aug. 2011 4 „Tylenol can kill you; new warning admits popular painkiller causes liver damage, death“, naturalnews.com vom 6. Dez. 2013 5 „Deadly NSAIDS“, Nutrition Digest, Vol. 37, No. 3, American Nutrition Association online 6 „Pediatricians warn against trampoline use at home, citing injury risks“, CBS online vom 24. Sept. 2012 7 Morbidity and Mortality Weekly Report (MMWR) May 18, 2012 / 61(19);344-347 8 „Car crash Fatality Statistics“, Statistic Brain Research Institute online – 22 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Was ist Multiple Sklerose? Multiple Sklerose (MS) ist eine Autoimmunerkrankung, bei der die Nervenhüllen (Myelinschicht) zerstört werden. Das zentrale Nervensystem wird geschädigt.1 Der Verlauf kann unterschiedlich sein. Man unterscheidet zwischen zwei Verlaufsformen: 1. Schubförmiger Verlauf: „Es bestehen neue Symptome über die Dauer von mindestens 24 Stunden, die nicht anderweitig erklärbar sind (zum Beispiel durch Fieber). Und seit dem Beginn des letzten Schubes sind mehr als 30 Tage vergangen.“ Solch ein Schub kann mehrere Tage oder Wochen dauern. Die Abstände zwischen den Schüben können zwischen Wochen, Monaten oder Jahren liegen. Die Symptome können wieder verschwinden oder erhalten bleiben. 2. Chronisch-voranschreitender Verlauf Selten beginnt MS in dieser Verlaufsform. Meist entspringt der chronisch-voranschreitende Verlauf aus dem schubförmigen Verlauf. Nach einer variablen Zeit kommt es allerdings zu einem langsamen, kontinuierlichen Fortschreiten der MS mit oder ohne zusätzlichen Schüben. Symptome und Beschwerden nehmen dabei allmählich zu. Symptome: – Empfi ndungsstörun gen an Armen und Beinen – Sehstörungen (vor allem bei jungen Patienten) – Störung der Muskelfunktionen, sowie Lähmungen – Koordinations- und Gleichgewichtsstörungen – Gangstörungen, Probleme beim Stehen – Spastik – Blasen- und Darmentleerungsstörungen – sexuelle Störungen – Sprachstörungen – sonstige Ursachen: „Trotz intensiver weltweiter Forschungsbemühungen ist die Ursache der MS bislang nicht eindeutig verstanden. Vieles spricht für eine Kombination aus begünstigenden Erbanlagen sowie Umwelteinfl üssen, die zu einer Multiple Sklerose als Impfschaden Multiple Sklerose (MS) ist eine der modernen Seuchen, die unsere Zivilisation heute anstelle von Pest & Co. heimsuchen. Während die Experten immer noch über die Ursachen rätseln, sind sie gleichzeitig sicher, dass es die Impfungen nicht sein können – was natürlich widersprüchlich ist. Dahinter steckt die Furcht, durch solche Vermutungen dem Impfgedanken – und damit der eigenen Karriere – zu schaden. Allen Leugnungen zum Trotz gehören Impfungen zu den Hauptverdächtigen. Dies wird auch durch erste offi zielle Anerkennungen von MS als Impfschaden bestärkt. Nachfolgend ein paar Urteile mit Aktenzeichen. Abdruck mit freundlicher Erlaubnis der Arbeitsgruppe IMPFormation (AGI), http://www.impformation.org © Minerva Studio – fotolia.com Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 23 – impf-report Nr. 109 4. Quartal 2015 Fehlreaktion des körpereigenen Abwehr- oder Immunsystems führt. Möglicherweise müssen mehrere Faktoren gleichzeitig vorliegen, damit die Erkrankung auftritt.“1 Lebenserwartung: – Man kann Jahre ohne schwerere Behinderungen mit MS leben. – Wann Behinderungen auftreten, ist unterschiedlich und kann nicht prognostiziert werden. – Bei schwerwiegenden Komplikationen liegt die Lebenserwartung zwischen 6 – 10 Jahren unter der allg. Lebenserwartung. – Weniger als zehn Prozent sterben an den direkten Folgen der Erkrankung beziehungsweise deren indirekten Komplikationen. Multiple Sklerose nimmt zu! „MS ist in Mitteleuropa die häu- fi gste chronisch-entzündliche Erkrankung des Zentralen Nervensystems. In der Bundesrepublik sind nach Angaben der Deutschen Multiple Sklerose Gesellschaft (DMSG) bis zu 140.000 Menschen daran erkrankt. Frauen werden doppelt so häufi g krank wie Männer. ‚Schlimm ist, dass es vor allem junge Menschen zwischen 20 und 35 Jahren triff t‘, sagt der Direktor der Neurologischen Klinik der Ruhr Universität Bochum, Ralf Gold, der auch Vorstandsmitglied des Ärztlichen Beirats der DMSG ist. ‚Leider ist auch die Zahl der Kranken steigend.‘ MS kann jeden Teil des Nervensystems befallen, dementsprechend vielgestaltig ist die Krankheit.“2 Natürlich werden in vielen Fachzeitschriften, Büchern, Webseiten usw. Impfungen als mögliche Ursache nicht benannt. Und das, obwohl es Anerkennungen von Impfschäden gibt (wenn auch wenige) und einige Fachinformationen die Erkrankung in der Gruppe der „Nebenwirkungen“ beinhalten. Beispiele zur Anerkennung von Impfschäden sowie Beispiele für einen aussichtslosen Kampf: Urteil SG Aachen 13. Kammer3 „Der am (…) geborene Klä- ger leidet an Multipler Sklerose (MS). Diese Erkrankung ist als Impfschaden anerkannt. (…) Am 12.01.2010 beantragte der Kläger durch den behandelnden Internisten S. die Versorgung mit einer Kühlweste. Der Antrag wurde damit begründet, der Kläger leide unter häufi g wiederkehrenden Spasmen der Muskulatur; ihm – dem Arzt – sei bekannt, dass eine Kühlung zu einer deutlichen Verringerung der Spastik führen könne; hierzu seien im Rahmen einer Kältetherapie Kühlsysteme entwickelt worden. Die Beklagte lehnte den Antrag durch Bescheid vom 25.01.2010 ab mit der Begründung, die Kühlweste sei kein Hilfsmittel nach § 33 SGB V und somit keine Leistung der gesetzlichen Krankenkasse.“ (Hervorhebung hinzugefügt) Urteil LSG Nordrhein- Westfalen 15. Juni 20124 „Die Klägerin, die approbierte Zahnärztin ist und bei der eine Encephalomyelitis disseminata (multiple Sklerose – MS) diagnostiziert worden ist, begehrt die Feststellung, dass diese Erkrankung Folge von Hepatitis-Schutzimpfungen ist, denen sie sich 1998 und 2001 unterzogen hat. (…) Die Klägerin wurde mit dem Impfstoff Engerix B erstmals am 24.04.1998 gegen Hepatitis B (HBV) geimpft. Am 11.05.1998 zeigte sich bei ihr eine Lymphknotenschwellung (Lymphadenitis) und konsekutiv am 18.05.1998 eine Mandelentzündung (Tonsillitis). Drei Tage später erfolgte die Verdachtsdiagnose Pfeiff ersches Drüsenfi eber (infektiöse Mononukleose, ausgelöst durch das Ebstein-Barr Virus). Die zweite HBV-Impfung erfolgte am 17.06.1998, der wiederum eine Lymphadenitis mit längerem zeitlichem Verlauf folgte. Die dritte HBV-Impfung wurde am 28.10.1998 durchgeführt. Am 30.11.1999 klagte die Klägerin über Missempfi ndungen (Parästhesien) im Bereich des Gesäßes, der Oberschenkelbeuger und der Fußsohlen. Der behandelnde Neurologe Dr. S schloss insoweit eine neurologische Ursache nicht aus. Am 16.02.2001 erfolgte eine Auff rischungsimpfung. Am selben Tag diagnostizierte Dr. E eine Neuralgie. Im April 2002 beklagte die Klägerin erneut Parästhesien im Bereich der Hand und des Kniegelenks, weswegen unter anderem der Verdacht auf eine abortive Form eines Lupus erythematodes mit diskreter Arthritis und neurologischen Symptomen der Hand von Dr. S geäu- ßert wurde. Im September 2002 wurde erstmals der Verdacht auf eine neurologische Erkrankung vermerkt und am 14.04.2003 im Universitätsklinikum N die Diagnose einer entzündlichen ZNS-Erkrankung gestellt, wo schließlich am 11.07.2005 eine entzündliche ZNS-Erkrankung im Sinne einer MS diagnostiziert wurde.“ „Mit Urteil vom 22.07.2011 hat das SG die Klage abgewiesen. Auf die Entscheidungsgründe wird Bezug genommen.“5 Das Gericht (der Beklagte): „Er hält das angefochtene Urteil für zutreff end und beruft sich auf eine weitere Stellungnahme von Dr. C, die darauf verweist, dass es sich bei der HBV-Impfung um eine gut verträgliche Impfung handle und die Studie von Hernan et. al auch durch die WHO verworfen worden sei.“ Urteil LSG Schleswig Holstein 14.06.20116 „Der Kläger ist Berufssoldat und gehört der Bundeswehr seit Juli 1983 an. Zur Vorbereitung eines geplanten Auslandseinsatzes wurde er am 10. Januar sowie 13. Februar 2001 gegen Frühsommermeningoenzephalitis (FSME) mit dem Impfstoff Encepur geimpft. Jedenfalls am 13. Februar 2001 erfolgte gleichzeitig eine Impfung gegen Typhus mit dem Impfstoff Typherix. Die Impfungen waren dienstlich angeordnet und erfolgten durch Bundeswehrärzte. Nachdem der Kläger vier Tage nach der zweiten Impfung Lähmungserscheinungen im linken Bein und im linken Arm verspürt hatte, wurde im Rahmen der daraufhin veranlassten eingehenden neurologischen Untersuchung eine Multiple Sklerose (MS) festgestellt.“ (…) „Der Kläger hat auch keinen Anspruch auf Feststellung der Ur- – 24 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 sächlichkeit der gegenständlichen Impfungen lediglich für den ersten Schub der Multiplen Sklerose im Frühjahr 2001.“ (…) „Bei der Herstellung des Impfstoff es „FSME-Immun“ wurden zur Produktion des Saatvirus ursprünglich die Gehirne von Babymäusen verwendet und zur Konservierung Thiomersal benutzt. Seit Januar 1999 wird der Impfstoff ohne Thiomersal abgefüllt und seit Januar 2000 wird als Saatvirus ein mehrfach auf embryonalen Hühnerzellen passagierter Virus verwendet.“ (…) „Gründe für die Zulassung der Revision gem. § 160 Abs. 2 SGG bestehen nicht.“ Die Dauer der Streitigkeiten vor Gericht betragen Jahre. Sie sehen den Zeitpunkt der Impfung mit den folgenden Nebenwirkungen, und den des Urteils. Und oft darf man nach diesen Jahren mit einer Ablehnung vom Gericht rechnen. Hier weitere Fälle der Impfschadensanerkennung, die vom Gericht nicht veröff entlicht wurden.7 Urteil S 11 VJ 2/01 des Sozialgerichts Lüneburg vom 15.04.2003: Impfschaden Multiple Sklerose als Folge einer Schutzimpfung gegen Polio, Diphtherie und Tetanus. Urteil S 1 VJ 1/04 des Sozialgerichts Würzburg vom 28.10.2005: Impfschaden Multiple Sklerose als Folge einer Schutzimpfung gegen Polio. Urteil S 15 VJ 1/06 des Sozialgerichts Landshut vom 08.04.2008: Impfschaden Multiple Sklerose als Folge einer Schutzimpfung gegen Hepatitis A+B (Twinrix). Urteil S 15 VJ 2/07 des Sozialgerichts Landshut vom 14.09.2009: Impfschaden Multiple Sklerose als Folge einer Schutzimpfung gegen Hepatitis B (Gen H-B-Vax). – Urteil L 6 VJ 4797/07 des Landessozialgerichts Baden-Württemberg vom 13.07.2010: Impfschaden Multiple Sklerose als Folge einer Schutzimpfung gegen FSME. MS in den Fachinformationen Schauen Sie sich bitte immer die Fachinformationen an. In einigen Fachinformationen wird Multiple Sklerose entsprechend angegeben. Hier als Beispiel der Engerix b Impfstoff (Hepatitis B):8 Erkrankungen des Nervensystems: „Enzephalitis, Enzephalopathie, Krampfanfälle, Lähmungen, Neuritis, (einschließ- lich Guillain Barré-Syndrom, Optikusneuritis und Multiple Sklerose), Neuropathie, Hypo- äthesien.“ In anderen Fachinformationen fi nden Sie dies unter Bezeichnungen wie: Demyelinisierung des Zentralnervensystems, Meningoencephalitiden inklusive akute demyelinisierende Encephalomyelitis, Verschlechterungen einer vorbestehenden entzündlichen ZNS-Krankheit etc. Hier als weiteres konkretes Beispiel Encepur Impfstoff (FSME)9 „Nach FSME-Impfungen wurden in Einzelfällen Erkrankungen des zentralen Nervensystems (z.B. Encephalitiden, Meningoencephalitiden inklusive akute demyelinisierende Encephalomyelitis, Leukoencephalomyelitis, (Querschnitts-) Myelitis, Verschlechterungen einer vorbestehenden ent zündlichen ZNS-Krankheit, asep tische Meningitis, Krampfanfälle, Vestibularneuritis, Oculomotorius-Paresen, Facialisparesen, usw.) oder peripheren Nervensystems, einschließlich aufsteigender Lähmungen bis hin zur Atemlähmung (z. B. Guillain-Barré-Syndrom) beschrieben.“ Informieren Sie sich! Impfungen können die Ursache von der Multiplen Sklerose sein! Ihr AGI-Team! Fußnoten: 1 „Multiple Sklerose (MS): Verlaufsformen und Prognose“, Apotheken-Umschau online vom 8. Okt. 2014 2 „Immer mehr Menschen leiden an Multipler Sklerose“, WELT online vom 29. Okt. 2009 3 „Kein Anspruch auf Versorgung mit einer Kühlweste bei Multipler Sklerose“, rehadat.info 4 „LSG Nordrhein-Westfalen · Urteil vom 15. Juni 2012 · Az. L 13 VJ 59/11“, auf openjur.de 5 siehe Fußnote 4 6 AZ L 2 VS 55/10, http://www.schleswig-holstein.de 7 http://www.impfschaden.info/ impfschäden/rechtliche-anerken nung.html?start=6 8 Fachinformation Engerix-B Erwachsene, Stand Dezember 2011, auf dimdi.de 9 Fachinformationen zu Encepur N bei: open drug database online, http://ch.oddb.org Die neuen Standardwerke der Impfkritik von Hans U. P. Tolzin Macht Impfen Sinn? Band I Paperb. / 318 S. / 19,90 € Die Tetanus-Lüge Paperb. / 300 S. / 19,90 € Die Seuchen-Erfi nder Paperb. / 290 S. / 19,90 € Bestellungen: http://www.tolzin-verlag.com Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 25 – impf-report Nr. 109 4. Quartal 2015 „Pate der Autoimmunität“* Niemand wird Yehuda Shoenfeld als Quacksalber bezeichnen. Der israelische Kliniker hat mehr als drei Jahrzehnte mit dem Studium des menschlichen Immunsystems verbracht und steht an der Spitze seines Fachgebiets. Man könnte sagen, dass er mehr der Basis als dem Rand seines Fachgebiets nahe steht – er verfasste Lehrbücher wie The Mosaic of Autoimmunity, Autoantibodies, Diagnostic Criteria in Autoimmune Diseases, Infection and Autoimmunity, Cancer and Autoimmunity, und die Zahl seiner Werke beträgt insgesamt 25 Bücher, von denen einige zu den Grundpfeilern der klinischen Praxis zählen. Da überrascht es wenig, dass Shoenfeld auch als “Pate der Autoimmunologie” bezeichnet wurde, jenes Teilgebiets der Immunologie, bei dem sich das menschliche Immunsystem gegen den Organismus wendet und einer breiten Auswahl von Erkrankungen wie Diabetes Typ I, Colitis ulcerosa*, und Multipler Sklerose den Weg bahnt. Etwas Seltsames fi ndet aktuell in der Welt der Immunologie statt und ein kleiner Beleg dafür ist es, wenn der “Pate der Autoimmunologie” auf Impfstoff e – und da speziell auf einige der Inhaltsstoff e wie das toxische* Metall Aluminium – hinweist, die einen wichtigen Beitrag zur global wachsenden Epidemie der Autoimmunkrankheiten leisten. Als Beweis dient eine große Menge an Forschungsergebnissen aus den letzten 15 Jahren, die in den vergangenen 5 Jahren noch Auch für eingefl eischte Impfbefürworter wird es immer schwieriger, die wachsende Anzahl von Forschungsarbeiten zu ignorieren, die belegen, dass aluminiumhaltige Impfstoffe massenweise Autoimmunerkrankungen auslösen. Noch haben die entsprechenden Veröffentlichungen einen geradezu schizophrenen Charakter, wenn in den gleichen Publikationen versucht wird, dem Ruf der Impfungen nicht zu schaden. Doch bis es zu einer Einsicht der Verantwortlichen und zu neuen unbedenklicheren Impfstoffen kommt, stellen sich viele Menschen die Frage: Wer ist empfänglich und welche Personen haben das größte Risiko? Celeste McGovern, http://www.greenmedinfo.com Übersetzung: Axel Berendes Selbstattacke elbstattacke Wie Impfstoffe unser Immun- ie Impfstoffe unser Immunsystem gegen uns aufbringen ystem gegen uns aufbringen * Worterklärungen Autoimmunreaktion Krankhafte Abwehrreaktion des Immunsystem gegenüber körpereigenem Gewebe (grch. autos „selbst“ + lat. immunis „frei, unberührt, rein“) Colitis ulcerosa entzündliche Darmerkrankung mit anhaltenden Durchfällen, Darmblutungen und schmerzhaften Krämpfen (collitis: grch. colon „Dickdarm“ + -itis „Entzündung“; Ulcerosa: ulcus „Geschwür“ ) toxisch giftig (lat. toxicum „Pfeilgift“, von grch. toxon „Pfeil“) © Vertigo Signs – fotolia.com – 26 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 einmal kräftig zugenommen hat. Als Beispiel dafür gilt ein aktueller Artikel, der in der Zeitschrift Pharmacological Research veröff entlicht wurde, und in dem Shoenfeld und seine Kollegen bisher nicht da gewesene Richtlinien aussprechen und 4 Kategorien von Personen nennen, die am ehesten von impfstoff bedingten Autoimmunstörungen betroff en sind.1 “Einerseits verhindern Impfungen Infektionen, die Autoimmunstörungen auslösen können,” sagen die Autoren des Artikels, Alessandra Soriano von der Abteilung für klinische Medizin und Rheumatologie am Campus Bio-Medico in Rom, Gideon Nesher von der medizinischen Fakultät der Hebräischen Universität Jerusalem und Shoenfeld selbst, Gründer und Leiter des Zabludowicz-Zentrums für Autoimmunleiden des Sheba Medical Center in Hashomer. Shoenfeld ist zudem Autor von über 1.500 Forschungsberichten zu allen medizinischen Themen und Gründer des International Congress on Autoimmunology. “Andererseits existieren auch zahlreiche Berichte, in denen Autoimmunstörungen nach einer Impfung beschrieben werden und die darauf schließen lassen, dass Impfungen tatsächlich Autoimmunprobleme triggern können.“ Zu den defi nierten Autoimmunleiden, die nach einer Impfung auftreten können, gehören Arthritiden*, der systemische Lupus erythematodes (SLE)*, Diabetes mellitus, Thrombozytopenien*, Vasculitiden*, Dermatomyositis*, das Guillan Barre Syndrom (GBS)* und demyelinisierende* (entmarkende) Störungen. Nahezu alle Arten von Impfstoff en sind mit dem Beginn eines sogenannten ASIA (Autoimmune/ infl ammatory Syndrome Induced by Adjuvants – autoimmunes/ entzündliches Syndrom durch Adjuvanzien, also Impfstoff -Hilfsstoff e) in Verbindung gebracht worden. Das ASIA-Syndrom, auch als das Shoenfeld-Syndrom bekannt, wur de als erstes vor vier Jahren im Journal of Autoimmunology beschrieben.2 Es handelt sich beim ASIA-Syndrom um einen Sammelbegriff für eine Gruppe ähnlicher Beschwerden wie dem Chronischen Erschöpfungssyndrom (CFS), die nach dem Kontakt mit einem Adjuvans* oder Umweltstoff en auftreten, wie sie in handelsüblichen Impfstoff bestandteilen enthalten sind, die das Immunsystem stimulieren. Seit jener Zeit sind eine erkleckliche Anzahl an Forschungsergebnissen über das ASIA-Syndrom entstanden und haben damit angefangen, das Geheimnis zu lüften, wie Umweltgifte, insbesondere das Metall Aluminium, aus Impfstoff en bei vorbelasteten Personen eine Kettenreaktion im Immunsystem auslösen können, die zu einer off ensichtlichen Autoimmunerkrankung auswachsen kann. Eine Autoimmunstörung tritt auf, wenn sich das körpereigene Abwehrsystem, das eigentlich fremde Eindringlinge angreifen soll, gegen Teile des eigenen Organismus wendet (der Begriff „auto“ kommt aus dem Griechischen und bedeutet “selbst“). Vergleicht man das Immunsystem mit dem nationalen Verteidigungsapparat, ähneln die Antikörper Drohnen, die darauf programmiert sind, bestimmte Arten von Eindringlingen (z. B. ein Bakterium oder Virus) zu erkennen und ihn dann zu zerstören bzw. für die Zerstörung durch andere Spezialkräfte zu markieren. Autoantikörper sind eine Sonderform dieser Drohnen, die einen Bestandteil des Körpers fälschlicherweise als Eindringling identi- fi zieren und dagegen eine Abwehraktion einleiten. Gilt dieser Angriff beispielsweise der Hülle um die Neuronen (Nervenzellen), können Nervenimpulse nicht mehr regelrecht übertragen werden, Muskeln verkrampfen sich und es kommt zu Fehlern in ihrer Koordination, was in einer multiplen Sklerose endet. Konzentrieren sich die Autoantikörper auf die Gelenke, kommt es zu einer rheumatoiden Arthritis. Gilt der Angriff den Langerhansschen Inseln in der Bauchspeicheldrüse, führt diese Fehlreaktion des Immunsystems zu einem Diabetes. “Während unseres gesamten Lebens bewegt sich das normale Immunsystem auf einer feinen Grenze zwischen der Erhaltung der normalen Abwehrreaktion und der Entwicklung von Autoimmunstörungen”, ist in dem Artikel zu lesen. “Das gesunde Immunsystem ist Selbst-Antigenen gegen- über tolerant. Wird diese Toleranz gestört, kommt es zu einer Regulationsstörung des Immunsystems, was zum Auftreten einer Autoimmunkrankheit führen kann. Die Impfung lost eine jener Situationen aus, die diese Homöostase* in empfänglichen Individuen stören kann, was in Autoimmunphänomenen und einem ASIA-Syndrom gipfelt.” “Wer ist empfänglich” ist das Thema des Artikels mit dem Titel „Predicting post-vaccination autoimmunity: Who might be at risk? (Vorhersage einer Autoimmunstörung nach Impfung – wer ist gefährdet?)”. Er führt vier Gruppen von anfälligen Personen auf: 1. Personen, bei denen es bereits zuvor zu einer Autoimmunreaktion nach einer Impfung gekommen ist, 2. Jeder, der auch sonst unter einer Autoimmunstörung leidet bzw. gelitten hat, 3. Patienten mit bekannten allergischen Reaktionen, Prof. Yehuda Shoenfeld gilt in der Fachwelt als der führende Experte für Autoimmun-Erkrankungen. Er sieht ein großes Problem in aluminiumhaltigen Impfstoff en. Seine Forschungsergebnisse sind alarmierend. Quelle: wikipedia.de Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 27 – impf-report Nr. 109 4. Quartal 2015 4. Jeder, bei dem die erhöhte Gefahr einer Autoimmunreaktion besteht, z. B. bei Menschen, in deren Familie bereits Autoimmunleiden aufgetreten sind, das Vorhandensein von Autoantikörpern, das man durch eine Blutuntersuchung klären kann und weitere Faktoren wie niedrige Vitamin D-Spiegel und Rauchen. Frühere Autoimmun-Reaktionen Dabei geht es um Personen, bei denen es bereits früher zu einer unerwünschten Reaktion auf Impfstoff e gekommen ist. Der Artikel führt fünf relevante Studien auf, darunter den Todesfall eines weiblichen Teenagers, sechs Wochen nach ihrer dritten Gardasil-Impfung gegen das Humane Papilloma-Virus (HPV). Bei der Betroff enen war es schon kurz nach der ersten Gardasil-Injektion zu einer Reihe von Beschwerden wie Schwindel, Taubheitsgefühle, Kribbeln in den Händen und Gedächtnisausfällen gekommen. Nach der zweiten Injektion entwickelte sich eine “intermittierende* Schwäche der Arme, eine andauernde Mü- digkeit, die täglich mehrere Nickerchen erforderlich machte, vermehrte Kribbelgefühle, nächtliche Schweißausbrüche, Brustschmerzen und Herzrasen“. Eine vollständige Autopsie führte zu keinem Ergebnis, während sich bei einer Analyse von Blut und Milzgewebe HPV-16-L1 Gen-DNA-Fragmente fanden, die zu der DNA passten, die man in den Ampullen des Gardasil-Impfstoff s gegen Gebärmutterhalskrebs fand, ”… was den Impfstoff als kausalen* Faktor erkennen lässt.” Wie man herausgefunden hatte, waren diese DNA-Fragmente zudem ”… mit dem Aluminium-Adjuvans Verbindungen eingegangen”, die nach Angaben aus dem Bericht weitere 8 bis 10 Jahre existieren und zu einer chronischen Reizung des Immunsystems führen können “Auch wenn die Daten begrenzt sind”, schreiben Shoenfeld und Kollegen, ”scheint es vorteilhaft, dass Personen mit vorherigen Autoimmun- oder autoimmunähnlichen Reaktionen auf Impfungen nicht weiter geimpft werden sollten, und das vor allem nicht mit dem gleichen Impfstoff .” * Worterklärungen Adjuvans Hilfsstoff zur Verstärkung der Immunreaktion (lat. adjuvare „helfen“) Arthritis Gelenkentzündung (grch. arthron „Glied, Gelenk“ + -itis „Entzündung“) ASIA Autoimmune/ infl ammatory Syndrome Induced by Adjuvants -Autoimmunes/entzündliches Syndrom durch Adjuvanzien (Impfstoff -Hilfsstoff e) CFS Abkürzung für „chronic fatique syndrome“ (engl.), „chronisches Erschöpfungssyndrom“ Demyelinisierung krankhafter Rückgang der fettähnlichen Isolierschicht um die Nervenzellen des Rückenmarks (lat. de „von, weg, ent-“ + myelos „Mark“) Dermatomyositis Muskelentzündung mit Hautbeteiligung. Die Ursachen sind unbekannt (grch. derma „Haut“ + myos „Muskel“ + -itis „Entzündung“) GBS (Guillan Barré Syndrom) Erkrankung der Nervenwurzeln des Rückenmarks. Verschiedene neurologische Symptome können auftreten, vor allem aufsteigende Lähmungen, ähnlich der Polio (Kinderlähmung). Das Syndrom wurde erstmals im ersten Weltkrieg von den französischen Ärzten Georges Charles Guillain und Jean-Alexandre Barré beschrieben Homöostase Aufrechterhaltung eines Gleichgewichtszustandes durch Selbstregulation (grch. homoios „gleichartig“ + statis „das Stehen“) intermittierend zeitweilig aussetzend u. wiederkehrend, mit Unterbrechungen erfolgend (lat. intermittere „dazwischenlegen“) Inzidenz Anzahl neuer Erkrankungsfälle (lat. incidens „hineinfallend“) kausal ursächlich (lat. causa „Ursache“) Kontraindikation Gegenanzeige; Umstand, der eine an sich als zweckmäßig erscheinende Behandlung als nicht geboten erscheinen läßt. (lat. contra „gegen“ + lat. indictio „Ankündigung“) SLE (Systemischer Lupus erythematodes) mehrere Körperteile befallende Schmetterlingsfl echte. Autoimmunerkrankung, die körpereigenes Gewebe angreift, was sich in fl ächenförmigen roten Hautausschlägen äußern kann. Früher erinnerten die nach Abheilung zurückbleibenden Narben an Wolfsbisse (lat. lupus „Wolf“ + grch. erythema „Röte“ + -odes „ähnlich wie“) Thrombozytopenie Mangel an Thrombozyten (Blutplättchen) im Blut (grch. thrombos „geronnene Masse, Klumpen, dicker Tropfen“ + lat. zytus „Zelle“, von grch. kytos „Höhlung, Urne“ + penia „Mangel“ ) Bekannte Autoimmunprobleme Zu der zweiten Gruppe von Personen, die man laut der Arbeit von einer Impfung ausnehmen sollte, gehören Patienten mit “be- – 28 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 kannten Autoimmunproblemen”. Bei ihnen wirken die Impfstoff e nicht so gut, sagen Shoenfeld und Kollegen und sie sind durch “Ausbrüche nach einer Impfung” gefährdet. Impfstoff e mit Lebendviren wie Windpocken-, Gelbfi eber- und dem Dreifachimpfstoff gegen Masern, Mumps und Röteln (MMR) sind für Personen mit bekannten Autoimmunstörungen wegen der Gefahr einer “unkontrollierten Virenreplikation* (…) generell kontraindiziert”. Aber auch die inaktivierten Impfstoff e sind hier keine wirklich gute Idee, da sie in der Regel als zusätzlichen Inhaltsstoff Aluminium enthalten, das mit Autoimmunproblemen in Zusammenhang gebracht wird. Die Immunologen weisen auf aktuelle Studien hin, in denen Patienten mit einem autoimmunen rheumatischen Leiden den Grippeimpfstoff (ohne Aluminium) erhalten hatten, daraufhin mehr unter Gelenkschmerzen und Fieber litten, als Angehörige einer Kontrollgruppe und deren Autoantikörper-Spiegel (die Drohnen, die uns selbst angreifen) nach Erhalt des Grippeimpfstoff s angestiegen waren. Darüber hinaus entwickelten sich bei diesen Personen neue Arten von Autoantikörpern, die vor der Impfung nicht da gewesen waren und die erhalten blieben. Da die Anwesenheit von Autoantikörpern bei Patienten ohne Symptome einen Voraussagefaktor für die Entwicklung einer Autoimmun erkrankung darstellen können, ist das für jeden, der etwas von Immunologie versteht, ausreichend Grund zur Besorgnis. Eine Anzahl von Arbeiten haben die Behauptung aufgestellt, Impfstoff e wären für eine ”überwältigende Mehrheit von Patienten mit bestehenden Autoimmunerkrankungen sicher”, aber da sich diese Studien nur mit der rheumatoiden Arthritis und dem Lupus erythematodes, nicht aber mit schweren und akuten Fällen beschäftigt haben, warnen die Autoren, man müsse die ”… potenziellen Vorteile der Impfung gegen deren mögliche Gefahren abwä- gen.” Patienten mit Allergien Von Impfstoff tests sind “verwundbare Individuen” üblicherweise ausgenommen – es werden nur sehr gesunde Personen ohne Allergien rekrutiert. Das ist ein Selektions-Bias*, so Soriano und Shoenfeld, der vermutlich zu schweren Nebenwirkungen geführt hat, die im “richtigen Leben, wo man bei allen Personen Impfstoff e ohne Rücksicht auf ihre Anfälligkeit verwendet”, erheblich unterschätzt wurden. Die wahre Inzidenz von allergischen Reaktionen auf Impfungen, die normalerweise auf eins unter 50.000 bis eins unter 1 Million Impfungen geschätzt wird, ist vermutlich deutlich höher – und das besonders dann, wenn Gelatine oder Hühnereiproteine auf der Zutatenliste stehen, so die Autoren. Es gibt eine lange Liste von Impfstoff bestandteilen, die potenziell allergieauslösend wirken: Neben den infektiösen Wirkstoff en sind das einerseits jene aus Hühnereiern, Pferdeserum, Backhefe, zahlreichem Antibiotika, Formaldehyd und Laktose, andererseits “unbeabsichtigte” Zutaten wie Latex. Die allergische Krankengeschichte einzelner Personen muss nach Ansicht der Forscher vor einer Impfung umfangreich erforscht werden. Leider zeigen sich einige Anzeichen einer allergischen Reaktion erst nach erfolgter Injektion. Die Gemeindeschwester oder der Hausarzt können den Patienten z. B. erzählen, dass eine lang verbleibende Schwellung rund um die Injektionsstelle nach einer Impfung eine normale Reaktion ist. Aber das entspricht nicht dem, Das Leichtmetall Aluminium ist in vielerlei Hinsicht sehr nützlich. Allerdings hat es aufgrund seiner extremen Reaktionsfreudigkeit innerhalb von biologischen Systemen keinerlei Funktion. Im Gegenteil: Selbst in geringsten Mengen versetzt es das Immunsystem in einen extremen Alarmzustand, der zu den verschiedensten Autoimmunerkrankungen führen kann. © Kybele – fotolia.com Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 29 – impf-report Nr. 109 4. Quartal 2015 was der Immunologe sagen würde: ”Eine [Aluminium-] Sensibilisierung zeigt sich durch Knötchen an der Injektionsstelle, die häufi g nach Wochen oder Monaten verschwinden, die aber auch Jahre verbleiben können”. In solchen Fällen, so die Autoren, kann ein Hauttest durchgeführt werden, um eine Sensibilisierung zu bestätigen und eine weitere Impfung zu verhindern. Nach den ständig zahlreicher werdenden Forschungsergebnissen aber könnten diese Allergien nur der Beginn von zahlreichen gefährlichen, durch Aluminium bedingten Phänomenen sein. Das Problem mit dem Aluminium Aluminium wird den Impfstoff en etwa seit 1926 beigegeben, seit Alexander Glenny und seine Mitarbeiter bemerkten, dass es im Impfstoff bessere Antikörperreaktionen auslöst, als das Antigen allein. Glenny nahm an, das Aluminium produzierte etwas, was er als “Depoteff ekt” bezeichnete – eine Verlangsamung der Antigenfreisetzung und eine Steigerung der Immunantwort. 60 Jahre lang wurde diese Theorie als Dogma akzeptiert, und in der gleichen Zeit nahm die Zahl der Einzelimpfungen des Impfprogramms Jahrzehnt für Jahrzehnt zu. Kaum jemand kam auf die Idee, die Wirkung der Injektion von Aluminium zu hinterfragen, was angesichts der bekannten Toxizität des Metalls schon recht seltsam ist. Eine PubMed-Recherche zu den Begriff en “Aluminium” und “Toxizität” erbringt 4.258 Treff er. Die giftige Wirkung des Metalls auf das Nervensystem (Neurotoxizität) ist gut dokumentiert. Sie betriff t Gedächtnis, Erkenntnis und die psychomotorische Steuerung, zerstört die Blut-Hirn-Schranke, aktiviert Entzündungen im Gehirn, unterdrückt die Funktion der Mitochondrien*, und die Mehrzahl der Forschungsergebnisse lässt vermuten, dass das Aluminium ein wichtiger Akteur bei der Bildung von Amyloid-Plaques* im Gehirn der Alzheimerpatienten ist. Es ist an der amyotrophen Lateralsklerose (ALS) und am Autismus beteiligt und kann Allergien auslösen. Als man Dialysepatienten irrtümlich Aluminiuminfusionen verabreichte, entwickelte sich bei ihnen eine dialysebedingte Enzephalopathie (DAE): Die betroff enen Patienten litten unter neurologischen Symptomen, Anomalitäten der Sprache, Muskelzittern, Gedächtnisverlust, gestörter Konzentrationsfähigkeit und Verhaltensänderungen. Viele der betroff enen Patienten fi elen ins Koma und starben. Die Glücklicheren überlebten, und nachdem man die Ursache der Beschwerden – das Aluminium – aus der Dialyse entfernte, erholten sie sich rapide. Mit diesen neuen Erkenntnissen begannen Wissenschaftler die Wirkung von Aluminium als Hilfsstoff zu untersuchen, und im vergangenen Jahrzehnt hat diese Forschung eine Vielzahl von Resultaten gebracht.3 Es hat sich herausgestellt, dass Aluminiumsalze einen wahren Abwehrsturm entfachen. Innerhalb weniger Stunden, nachdem man Mäusen Aluminiumoxyhydroxid aus Impfstoff en injiziert hatte, sind z. B. ganze Armeen von spezialisierten Immunzellen auf dem Marsch und aktivieren weitere spezialisierte Angriff struppen. Innerhalb eines Tages werden eine Auswahl von Kommandotruppen des Immunsystems aktiv – Neutrophile, Eosinophile, entzündungsfördernde Monozyten, Myeloid- und Dendridenzellen, aktivierende Lymphozyten und als Zytokine bekannte Eiweiß- stoff e. Diese Zytokine selbst rufen Kollateralschäden hervor und senden Signale aus, mit denen sie die Kommunikation unter den Zellen steuern und weitere Zellen in Aktion rufen. An der nächsten Angriff swelle können dann sog. fi broblastische Wachstumsfaktoren, Interferone, Interleukine, Wachstumsfaktoren von Blutplättchen, transformierende Wachstumsfaktoren und Tumornekrosefaktoren (TNF) beteiligt sein. Es gibt Hinweise darauf, dass wenig verstandene, gefährliche, sogenannte Infl ammasome – derzeit Thema der Erforschung der Krebsenststehung – wie der NOD-ähnliche Rezeptor-3 (NLRP), ebenfalls aktiviert werden. Was genau diese Infl ammasome bewirken, ist zur Zeit noch unbekannt Wie aktuelle Forschungsresultate der Universität von British Columbia gezeigt haben, kann der Hilfsstoff Aluminium, den man Mäusen injiziert hat, die Expression (Aktivierung) von Genen verändern, die mit der Autoimmunität in Zusammenhang stehen. Und in ihrer letzten Studie, die in der Zeitschrift Proceedings of the National Academy of Sciences veröff entlicht wurde, haben * Worterklärungen ALS (amytrophe Lateralssklerose) fortschreitende schwere Schädigung von motorischen Nervenzellen mit diversen Lähmungssymptomen, die in etwa drei bis fünf Jahren zum Tod führen. Ursache laut Schulmedizin unbekannt (grch. a „nicht“ + myos „Muskel“ + trophe „Nahrung“ + lat. lateralis „die Seite betreff end“ + grch. sklerosis „Verhärtung“). Amyloid-Plaque Ablagerungen von entarteter Eiweißsubstanz, die als Ursache für manche Hirnerkrankungen angesehen werden (grch. amylon „Stärke“ + frz. plaque „Belag“) Granulom entzündungsbedingte knotenartige Gewebeneubildung (lat. granulom „Körnchen“, zu granum „Korn“) Läsion Verletzung (lat. laesio) Mitochondrien „Energiekraftwerke“ der Zellen (grch. mitos „Faden“ + chondros „Korn“) Selektions-Bias das Ergebnis verfälschender Verzerrungsfaktor bei der Auswahl von Testpersonen (lat. selectio „Auswahl“ + engl. bias „schief“) Virenreplikation Virenvermehrung (lat. replicare „wieder aufrollen, entfalten“) – 30 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Immunologen der Universität von Colorado herausgefunden, dass sogar die DNA des Wirtes während des Aluminiumangriff s rekrutiert wird und rasch injiziertes Aluminium ummantelt und dadurch Effekte auslöst, an deren Oberfl äche die Wissenschaftler eben erst zu kratzen begonnen haben. Die Bedeutung der Makrophagen-Myofasziitis (MMF) Die Beweglichkeit oder “Translokation” des Aluminiums im Körper ist vermutlich das beunruhigendste der ständig zunehmenden Indizien in der aktuellen Aluminiumforschung. 1998 beobachteten der französische Forscher Romain Gherardi und seine Mitarbeiter eine neue Erkrankung unbekannten Ursprungs, die sich nach einer Impfung bei Patienten mit den Symptomen eines CFS wie geschwollenen Lymphknoten, Gelenk- und Muskelschmerzen und Erschöpfungszuständen manifestierte. Gewebeentnahmen aus den Del ta-Muskeln der Betroff enen zeigten Schäden von bis zu 1 cm Durchmesser, die vollkommen anders aussahen als die Läsionen anderer Erkrankungen. Die Gewebeproben wurden im Labor analysiert und zu Gherardis Erstaunen bestanden sie überwiegend aus Makrophagen (Riesenfresszellen) – das sind große weiße Blutzellen des Immunsystems – , deren Aufgabe darin besteht, fremde Eindringlinge im Körper zu fressen. In der Zellfl üssigkeit dieser Fresszellen fanden sich Ansammlungen von Aluminium-Nanokristallen. Die Forscher gaben der neuen Krankheit den Namen „Makrophagische Myofasziitis“ (MMF). Gherardi und seine Mitarbeiter begannen damit, Mäusen Aluminium zu spritzen, um zu beobachten, was geschah. Ihre Ergebnisse, die 2013 veröff entlicht wurden, zeigten, dass die Metallpartikel von Makrophagen verschlungen worden waren und MMF-ähnliche Granulome bildeten, die sich in die Lymphknoten, die Milz, die Leber und schließlich auch ins Gehirn verteilten. “Das lässt stark vermuten, dass die längerfristige Biopersistenz* von Hilfsstoff en in phagozytischen Zellen* eine Vorbedingung für deren langsame Wanderung in das Gehirn sowie eine verzögerte Neurotoxizität darstellt“, schrieb Gherani in seinem Bericht vom Februar 2015 in der Zeitschrift Frontiers in Neurology.5 Ein noch erschreckenderer Tierversuch mit Aluminium ist die Arbeit des spanischen Veterinärs und Forschers Lluis Lujan über ASIA bei Schafen. Nachdem in Spanien 2008 in folge einer obligatorischen Massenimpfkampagne gegen die Blauzungenkrankheit eine große Anzahl an Schafen krepiert war, versuchte Lujan herauszufi nden, was die Tiere getötet hatte – und begann damit, sie mit Aluminium zu impfen. Seine Studie aus dem Jahr 2013 zeigte, dass nur 0,5 % der Schafe, denen er aluminiumhaltige Impfstoff e injiziert hatte, unmittelbare Reaktionen in Form von Lethargie, vorübergehendem Erblinden, Stupor*, Kniefall oder Krampfanfällen zeigten, ”… charakteristisch für eine schwere Meningoenzephalitis, ähnlich den Impfreaktionen, die man beim Menschen beobachtet hat.” Die meisten Tiere erholten sich vorübergehend, aber postmortale* Untersuchungen der Tiere, die das nicht taten, zeigten akute Entzündungen des Gehirns. Der verzögerte Beginn der chronischen Phase der Erkrankung fand sich bei deutlich mehr Schafen – 50 bis 70 % der Herden, virtuell 100 % der Tiere in einer Herde – und befi el in der Regel alle Tiere, die sich vorher erholt hatten. Die Reaktion wurde regelmäßig durch Kälte ausgelöst und begann mit Ruhelosigkeit und obligatorischem Wollbeißen, setzte sich dann mit einer akuten Rötung der Haut, genereller Schwäche, extremem Gewichtsverlust sowie Muskelzittern fort und ging schließlich in die Endphase über, in der die Tiere zusammenbrachen, komatös wurden und starben. Untersuchungen der toten Tiere zeigten “schwere Nekrosen der Nervenzellen und Aluminium im Nervengewebe.“ “Die Reaktionen des Immunsystems auf Aluminium repräsentieren eine wichtige gesundheitliche Herausforderung”, schrieb Gherardi in seiner aktuellen Arbeit und fügt hinzu, dass es “keine Bestrebungen gegeben hat, die Sicherheitsbedenken zu untersuchen, die durch den biopersistenten Charakter und die Anhäufung von Aluminiumpartikeln im Gehirn entstehen.“ … „Es muss noch viel getan werden, um begreifen zu können, wie aluminiumhaltige Asthma ist eine der möglichen Folgen aluminiumhaltiger Impfungen. Selbst wenn solche Autoimmunerkrankungen nur sehr selten auftreten, wäre dies für die Betroff enen ein zu hoher Preis. Doch die Häufi gkeit dieser Impfnebenwirkungen wird wahrscheinlich immer noch unterschätzt. © comodigit – fotolia.com Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 31 – impf-report Nr. 109 4. Quartal 2015 Impfstoff e bei bestimmten Individuen so gefährlich werden können”. Aber nun zurück zu der Frage, welche Personen auf eine Impfung verzichten sollten, um eine Autoimmunstörung zu vermeiden. Personen mit der Neigung zu Autoimmunproblemen Schließlich haben Soriano und Shoenfeld eine letzte Kategorie von Personen identifi ziert: Jeder, der dazu tendiert, eine Autoimmunkrankheit zu entwickeln. Da sich gezeigt hat, dass eine Reihe der Betroff enen bestimmte genetische Faktoren besitzt, gehört jeder zu dieser Gruppe, in dessen Familie bereits Fälle einer Autoimmunstörung aufgetreten ist. Dazu gehört auch jeder, dessen Testergebnis auf Autoantikörper positiv ausgefallen ist, was auf eine solche Erkrankung Jahre vor Erscheinen der ersten Symptome hinweist. “Impfungen”, so die Ärzte, können diese Erkrankung auslösen oder verschlimmern.” Auch Raucher haben ein au- ßerordentlich hohes Risiko, eine Autoimmunerkrankung zu entwickeln, so der Bericht. Die American Cancer Society schätzt, dass etwa 18 % der US-Bürger rauchen. Das bedeutet ungefähr, dass 42 Millionen Amerikaner vermehrt gefährdet sind, an einem Autoimmunleiden zu erkranken und dass diese Gefährdung mit jeder Impfung stärker wird. Schließlich sind weitere Faktoren, die Shoenfeld and Soriano mit einem hohen Risiko für Autoimmunprobleme in Verbindung bringen, erhöhte Östrogen- und niedrige Vitamin D-Spiegel – was heißt: Jeder, der die “Pille” einnimmt oder sich einer Hormonersatztherapie unterzieht und – folgt man einer Untersuchung des Vitamin D-Status aus dem Jahr 2009 – etwa drei Viertel der amerikanischen Teenager sollten sich also vor Impfungen hüten. Dennoch scheint Shoenfeld nicht der Meinung zu sein, man solle alle diese Menschen von Impfungen ausschließen. Der Bericht kommt zu dem Ergebnis, “für die Mehrheit der Bevölkerung stellen Impfungen keine Gefahr einer systemischen Autoimmunerkrankung dar und sollten den aktuellen Empfehlungen entsprechend durchgeführt werden.” Eine Schlussfolgerung, die im krassen Widerspruch zu den Informationen der Arbeit steht. Die letzte Bemerkung empfi ehlt, “potenzielle Vorteile einer Impfung gegen deren potenzielle Risiken abzuwägen.” Dieser Beitrag ist exemplarisch für jene Form von Schizophrenie, die man in einer großen Anzahl von immunologischen Arbeiten vorfi ndet. Die Ärzte scheinen zu versuchen, das Jahrhunderte alte Dogma von der “sicheren und eff ektiven” Impfung“ mit den erschreckenden Forschungsergebnissen des letzten Jahrzehnts versöhnen zu wollen. Es gibt in diesen Texten viele – vielleicht zu viele – Abwägungen wie “einerseits – andererseits” usw. Die neuen Forschungsergebnisse scheinen dennoch die Oberhand zu gewinnen. Eine Übersichtsarbeit zum ASIA-Syndrom aus dem Jahr 2013 von sechs Immunologen, darunter auch Yeshuda Shoenfeld, ist eigentlich nichts mehr und nichts weniger als ein Katalog von Impfstoff nebenwirkungen von Gardasil-Todesfällen, Narkolepsie-Epidemien, Unfruchtbarkeit, chronischer Erschöpfung, toten Schafen und mit Aluminium verseuchten Gehirnen.6 Sie strotzt vor Stellungnahmen, die man noch vor zehn Jahren im Inneren der Mainstream-Medizin praktisch niemals gehört hat – so wie z. B. dieser Schocker: “Vielleicht können Ärzte in 20 Jahren mit besser charakterisierten Partikeln der Autoimmunität kämpfen und die Impfstoff e können ebenso sicher wie eff ektiv werden. Trotzdem hat die Erkenntnis über das ASIA-Syndrom jene Veränderungen angekurbelt, um mehr Anstrengungen bei der Identifi zierung der guten, schlechten und hässlichen Impfungen einzuleiten. Besonders wichtig sind hier besonders die Adjuvanzien als Auslöser von Autoimmunstö- rungen”. Schlechte und hässliche Impfstoff e? Was stimmt nicht mit den Hilfsstoff en? Diese Informationen fi ndet man in den CDC-Merkzetteln* nicht. Oder wie wäre es mit diesem Kommentar? “Trotz der großen Menge an Geld, die für das Studium der Impfstoff e aufgewendet wurde, existieren nur sehr wenige Beobachtungsstudien und nahezu keine randomisierten* klinischen Untersuchungen über die Wirkung der bestehenden Impfstoff e * Worterklärungen CDC Abkürzung für Centers for Disease Control, US-Seuchenbehörde Morbidität Krankheitshäufi gkeit bezogen auf eine bestimmte Bevölkerungsgröße (von lat. morbidus „krank, ungesund“) Mortalität Sterblichkeit oder Sterberate bezogen auf eine bestimmte Bevölkerungsgröße innerhalb eines bestimmten Zeitraums (lat. mortalitas „das Sterben“) Persistenz Fortbestand, Beharrlichkeit, Ausdauer (lat. persistere „verharren“) phagozytische Zellen Fresszellen (grch. phagein „essen, fressen“ + kytos „Höhlung, Zelle“) postmortal nach dem Tod eintretend/ geschehend (lat. post „nach“ + mortis „Tod“) randomisiert nach dem Zufallsprinzip ausgewählt (engl. randomize) signifi kant bedeutsam, mit statistischer Aussagekraft, beweisfähig (lat. signifi care „etwas anzeigen“) Stupor Zustand völliger Unbeweglichkeit, Stummheit oder Reaktionslosigkeit gegenüber jeglichem Reiz bei erhaltenem Bewusstsein (lat. stupere „starr sein“) synergistisch zusammenwirkend (grch. syn „zusammen“ + ergon „Werk“) – 32 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 auf die Sterblichkeit. Wie eine neuere Arbeit zeigt, steht eine erhöhte Hospitalisierungsrate mit der Zunahme der Impfstoff – dosen in Zusammenhang und die Mortalitätsrate* mit 5 bis 8 (Impfstoff -) Dosen ist anderthalb Mal so hoch, wie die Rate von 1 bis 4 Impf-Dosen, was auf eine statistisch signifi kante* Zunahme der Todesfälle durch mehr Impfstoff dosen hinweist. Da Impfstoff e jährlich Millionen von Kindern verabreicht werden, ist es unumgänglich, dass die Gesundheitsbehörden über wissenschaftliche Daten aus synergistischen* Toxizitätsstudien aller Impfstoff – kombinationen verfügen (…) was aber nicht der Fall ist.“ Und hier kommt das Sahnehäubchen: “Der Oberste Gerichtshof der USA hat entschieden, dass die Impfstoff hersteller vor allen Verfahren geschützt sind, die dadurch zustande kommen, dass ein Impfstoff fehlerhaft ist. Daher besteht kein Bedarf für innovative klinische Studiendesigns und der Veränderung der Impfstoff e selbst.” Immunologen, darunter auch der weltweit führende Experte für Autoimmunerkrankungen, sagen, dass es an der Zeit wäre, alle Impfstoff e zurück in die Entwicklung zu schicken. Autoimmunerkrankungen stehen weltweit auf der Liste der Ursachen von Morbidität* und Mortalität an dritter Stelle und sind bei jungen amerikanischen Frauen auf der Top Ten der Todesursachen. Die American Autoimmune Related Diseases Association schätzt, dass etwa 50 Millionen US-Bürger an einer der 88 Autoimmunleiden – vom Diabetes Typ I bis zum systemischen Lupus erythematodes – erkrankt sind und global wird das Verhältnis von Betroff enen und nicht Betroff enen mit 1 zu 5 geschätzt. Mindestens 40 weitere Leiden stehen im Verdacht, ebenfalls durch das Immunsystem bestimmt zu werden. Die meisten Autoimmunerkrankungen sind sehr weitreichend, häufi g verunstaltend, teuer zu therapieren und oft genug unheilbar. Und sie nehmen in beunruhigendem Umfang zu. Zur Zeit sieht es so aus, als fi ele es den Impfbefürwortern unter den Immunologen um so schwerer, ihre multiplen Persönlichkeitsstö- rungen oder Nervenzusammenbrüche unter Kontrolle zu bekommen, je mehr geforscht wird. Zehn Jahre Erforschung der Eff ekte von Aluminium auf das Immunsystem sind ein Beweis dafür, wie falsch sie gelegen haben – und auch, wie wenig sie wissen. Wenn die Ärzte nach 90 Jahren endlich damit begonnen haben, ernsthaft die Mechanismen und Fragen zu untersuchen und den Sinn der Injektion von Metalltoxinen in Neugeborene zu hinterfragen – was muss da noch entdeckt werden? Der Begriff ASIA hört sich schon so furchtbar an, aber was wäre, wenn die “vernachlässigbare” Minderheit von Lujans Schafen nur die Spitze des Eisberges wäre? Was, wenn auch Menschen ohne off ensichtliche Immunreaktionen trotzdem Nanokristalle aus Aluminium im Körper haben, die sich heimlich in ihrem Gehirn ablagern? Was, wenn ASIA auch Alzheimer, ALS, Autismus, ADHS umfasst? Und das sind nur die Erkrankungen mit A. Selbst wenn die Immunologen immer noch ihre rosafarbene Brille tragen und die Inhaltsstoff e nur für einen Bruchteil der sich explosionsartig zunehmenden Autoimmunstörungen verantwortlich wären, das “Hässliche” in den Impfstoff en kann immer schwerer ignoriert werden. Obwohl quasi jedem Bewohner unseres Planeten Aluminium injiziert wird, duellieren sich Wissenschaftler mit den charakteristischen Partikeln der Autoimmunität und in den inzwischen vergangenen 20 Jahre warten die Geschädigten vergeblich darauf, ihr Recht zu bekommen. In der allgemeinen Raserei der Impf-Promoter über den Masern-Ausbruch in Disneyland läuft die Uhr für jene Mediziner und Forscher, welche die „schlechte und hässliche Seite von Impfstoff en und ihren Adjuvanzien sehen, etwas dagegen zu unternehmen. Die Chancen für eine Überarbeitung der Impfstoff e sind aus reinen Profi tgründen gering – und es spricht einiges dafür, dass eine universale Impfpfl icht für alle auf uns zukommen kann – unabhängig davon, ob jemand bereits eine anaphylaktische Impfreaktion erlitten hat oder nicht. Fußnoten: Originalartikel: Celeste McGovern, Attacking Ourselves: Top Doctors Reveal Vaccines Turn Our Immune System Against Us, GMI Daily, 5.08,.2015, greenmedinfo.com 1 Soriano A1, Nesher G2, Shoenfeld Y3, Predicting post-vaccination autoimmunity: who might be at risk?, Pharacol Resm 2015 Feb;92:18-22. doi: 10.1016/j. phrs.2014.08.002. Epub 2014 Sep 30. 2 Shoenfeld Y1, Agmon-Levin N., ‚ASIA‘ – autoimmune/infl ammatory syndrome induced by adjuvants. Autoimmun. 2011 Feb;36(1):4-8. doi: 10.1016/j. jaut.2010.07.003. Epub 15. August 2010 3 Marrack PI, McKee AS, Munks MW.; Towards an understanding of the adjuvant action of aluminium, Nat Rev Immunol. 2009 Apr;9(4):287-93. doi: 10.1038/ nri2510. 4 McKee AS1, Burchill MA, Munks MW, Jin L, Kappler JW, Friedman RS, Jacobelli J, Marrack P., Host DNA released in response to aluminum adjuvant enhances MHC class II-mediated antigen presentation and prolongs CD4 T-cell interactions with dendritic cells, Proc Natl Acad Sci U S A. 2013 Mar 19;110(12):E1122-31. doi:10.1073/pnas.1300392110. Epub 27. Feb 2013 5 Romain Kroum Gherardi, Housam Eidi, Guillemette Crépeaux, Fran- çois Jerome Authier and Josette Cadusseau, Biopersistence and brain translocation of aluminum adjuvants of vaccines, Frontiers of Neurology, Febraur 2015 6 Carlo Perriconea, Serena Colafrancescoa, Roei D. Mazora, Alessandra Sorianoa, Nancy Agmon-Levina, Yehuda Shoenfeld, Autoimmune/infl ammatory syndrome induced by adjuvants (ASIA) 2013: Unveiling the pathogenic, clinical and diagnostic aspects, Journal of Autoimmunlogy Volume 47, December 2013, Seiten 1–16 Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 33 – impf-report Nr. 109 4. Quartal 2015 Nach neuesten Hochrechnungen ist von 7 Millionen Flüchtlingen die Rede, die nach Deutschland kommen werden.1 Die größte Anzahl der Flüchtlinge kommt aus Syrien, gefolgt vom Kosovo und Albanien.2 Die STIKO hat im Oktober 2015 ein „Konzept zur Umsetzung frühzeitiger Impfungen bei Asylsuchenden nach Ankunft in Deutschland“ veröff entlicht. Asylsuchende würden aus Ländern stammen, die eingeschränkten Zugang zu medizinischer Versorgung und Impfungen hätten.3 Für Babys und Kleinkinder seien die 6-fach Impfung gegen Diphtherie, Tetanus, Keuchhusten, Polio, HiB und Hepatitis B sowie die 4-fach Impfung gegen Masern, Mumps, Röteln und Windpocken (MMRV) empfohlen. Für Kinder bis 13 Jahren die 4-fach Impfung gegen Diphtherie, Tetanus, Polio und Keuchhusten (TdaP-IPV) sowie die 4-fach Impfung MMRV. Ab dem Alter von 13 Jahren wird ebenfalls die 4-fach Impfung TdaP-IPV, sowie die 3-fach Impfung gegen Masern, Mumps und Röteln (MMR) empfohlen. Fast ein Drittel der Asylbewerber sind Kinder oder Jugendliche. Fast die Hälfte ist jünger als 35 Jahre.4 Rechnet man diese Anteile auf die geschätzten 7 Millionen Asylbewerber hoch, sind Impfungen für ca. 2,1 Millionen Minderjährige sowie ca. 3,5 Millionen junge Erwachsene geplant. Der erste Impftermin soll unverzüglich in den Ersteinrichtungen erfolgen, die weiteren Impfungen dann im weiteren Verlauf nach der Verteilung der Flüchtlinge. Die MMR(V)-Impfung wird zwei Mal verabreicht, die 4-fach Impfung TdaP-IPV drei Mal. In der Großpackung kosten eine Dosis MMR-Impfstoff bzw. eine Dosis TdaP-IPV-Impfstoff © Giovanni Cancemi – fotolia.com Die geschätzte Zahl der Flüchtlinge, mit denen Deutschland in naher Zukunft rechnen muss, wird derzeit ständig nach oben korrigiert. Viele Menschen befürchten die Einschleppung von Krankheitserregern. Doch die Asylbewerber wurden in ihren Herkunftsländern in der Regel gegen die üblichen Krankheiten durchgeimpft. Syrien hat sogar einen dichteren Impfkalender als Deutschland und die Durchimpfungsraten sind bekanntermaßen hoch. Die Ständige Impfkommission (STIKO) betrachtet dennoch jeden Asylbewerber ohne Impfpass grundsätzlich als ungeimpft. Dass die empfohlenen – großteils unnötigen – Impfungen den Steuerzahler Milliarden kosten werden, scheint die STIKO nicht zu kümmern. Das hängt vielleicht auch damit zusammen, dass die empfohlenen Impfstoffe zum Teil sowieso nicht lieferbar sind. Offensichtlich sehen STIKO und Gesundheitsbehörden keine reale Ansteckungsgefahr durch Asylbewerber. Warum dann die unnötigen Impfempfehlungen? von Angelika Müller, Eltern für Impfaufklärung (EFI) Flüchtlingsimpfungen: lüchtlingsimpfungen: Warum sagt uns die STIKO arum sagt uns die STIKO nicht die Wahrheit? icht die Wahrheit? – 34 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 mindestens 30 Euro (Apothekenverkaufspreis)5 . Rechnet man für 5,4 Millionen Asylbewerber zwei Dosen MMR-Impfstoff , sowie für 7 Millionen Asylbewerber drei Dosen Tdap-IPV Impfstoff , ergibt das eine Gesamtzahl von ca. 32 Millionen Impfstoff dosen à ca. 30 Euro, also Impfstoff kosten von 960 Millionen Euro.6 In dieser Berechnung fehlen noch die wesentlich höheren Kosten für Babyimpfstoff e in der Höhe von über 250 Euro Mehrkosten pro Baby. Laut STIKO-Empfehlungen sind zudem für alle Asylbewerber Infl uenzaimpfstoff e empfohlen, wovon eine Dosis zwischen 10 und 25 Euro kostet und pro Asylant zwei Dosen gegeben werden. Das ergibt also nochmal Impfstoff kosten von mindestens 140 Millionen Euro. Das Arzthonorar für die Impfung schwankt je nach Impfung (3-fach, 4-fach bzw. 6-fach) zwischen knapp 10 Euro und 20 Euro. Zu den Impfstoff kosten kommen also nochmal mindestens 320 Millionen Euro Kosten für Arzthonorare.7 Durchgeimpft – aber ohne Impfpass Selbst bei vorsichtiger Schätzung belaufen sich die erwarteten Kosten für Flüchtlingsimpfungen auf 1,5 Milliarden Euro. Bei dieser Summe stellt sich natürlich die Frage, ob das wirklich nötig ist. Die syrischen Impfkalender sind nämlich sogar noch umfangreicher als die deutschen und die Impfraten liegen je nach Jahr und Impfung zwischen 60 % und 100 %.8 Folglich wären laut offi ziellen Impfempfehlungen bei den meisten Asylbewerbern überhaupt keine Impfungen nötig! Das einzige Problem dabei ist, dass viele Flüchtlinge keine Impfpässe haben bzw. diese auf der Flucht verloren haben. Laut STIKO gelten jedoch nicht schriftlich dokumentierte Impfungen als nicht existent.9 In den speziellen Impfempfehlungen für Flüchtlinge wird daher betont:10 „Vorhandene Impfausweise sollen zur Klärung des Impfstatus nach Möglichkeit berücksichtigt werden. Grundsätzlich gilt eine Person ohne Impfdokumentation als ungeimpft und soll entsprechend Anlage 1 geimpft werden. Bei der Umsetzung des Mindest-Impfangebots können ausnahmsweise mündliche Angaben zu früher erfolgten Impfungen berücksichtigt werden, sofern sie als glaubwürdig eingeschätzt werden.“ Eine Blutuntersuchung zur Bestimmung des Immunstatus (durch Messung der Antikörper-Titer) bei verlorenem Impfpass zur Vermeidung von überfl üssigen Impfungen wird als nicht nötig erachtet: „Serologien zur Abwägung einer Impfentscheidung sind im Rahmen der Erstversorgung/ Betreuung in Erstaufnahmeeinrichtungen in der Regel nicht notwendig. Eine ‚Überimpfung‘ ist nicht möglich. Auch wenn eine impfpräventable Erkrankung bereits (unbemerkt) durchgemacht oder bereits dagegen geimpft wurde (ohne dokumentiert zu sein), kann geimpft werden.“ Ebenso wird es off ensichtlich als überfl üssig erachtet, den Impfstatus der einreisenden Flüchtlinge systematisch zu erheben, um die laut offi zieller Lehrmeinung vorhandene Infektionsgefahr Offi zielle Durchimpfungsraten in Syrien Die Durchimpfungsraten in Syrien legen laut dieser offi ziellen WHO-Tabelle nahe, dass weitaus die meisten Flüchtlinge aus Syrien Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 35 – impf-report Nr. 109 4. Quartal 2015 durch Asylbewerber einschätzen zu können.11 Eine Erhebung des Immunstatus wäre sinnvoll Falls es nicht nur um den zusätzlichen Umsatz für die Pharmaindustrie durch möglichst viele Flüchtlingsimpfungen ginge, sondern wirklich um die Gesundheit aller in Deutschland lebenden Menschen, wären die Daten zu Immunität und Impfstatus von höchster Priorität. Ebenso wäre es zur Vermeidung von unnötigen Impfungen absolut sinnvoll Bluttests zur Bestimmung des Impfstatus durchzuführen. Immerhin besteht bei jeder Impfung ein nicht zu unterschätzendes Risiko bezüglich Nebenwirkungen, zumal sich die Impfl inge nach der langen Flucht und den katastrophalen Umständen dabei in einem schlechten Allgemeinzustand befi nden. Zudem dürfte die ordentliche Anamnese, die z. B. zur Ermittlung von Gegenanzeigen vor der Impfung nötig ist, bei den meisten Flüchtlingen an der Sprachbarriere scheitern. Asylbewerber haben aus diesen Gründen ein erhöhtes Risiko für Impfnebenwirkungen. Die Folgekosten für die Behandlung dieser Impff olgen müssen konsequenterweise zu den Ausgaben für Impfstoff e und Arzthonorare hinzugerechnet werden. Die direkten und indirekten Aufwendungen für Flüchtlingsimpfungen belasten die öff entlichen Kassen im Milliardenbereich. Flüchtlingsimpfungen sind zudem in den meisten Fällen überfl üssig und schädlich! Trotz Lieferengpässen kein Anlass zur Sorge? Jetzt könnte man natürlich argumentieren, dass angesichts der drohenden Einschleppung von Infektionskrankheiten durch Asylbewerber keine Kosten gescheut werden dürften. Beispielsweise die Polio (Kinderlähmung) würde in den Heimatländern der Asylbewerber, z. B. in Syrien, durchaus noch vorkommen. Derzeit gibt es jedoch massive Lieferengpässe bei diversen Impfstoff en, wie sowohl beim RKI als auch beim PEI zu lesen ist.12,13 Beide vom RKI namentlich für die Flüchtlingsimpfungen empfohlenen 4-fach Impfstoff e gegen Tetanus, Diphtherie, Keuchhusten und Polio sind derzeit nicht lieferbar, ebenso der einzige Polio-Impfstoff . Die Handlungsempfehlung für diesen Fall fi nden Sie in den Abbildungen auf der nächsten Seite. Die aktuellen Impfempfehlungen der STIKO für Flüchtlinge sind folglich derzeit wegen massiver Lieferengpässe nicht möglich. Die Gesundheitsbehörden sehen die gesamte Situation jedoch absolut gelassen, es bestünde „kein Grund zur Sorge“ wegen der anhaltenden und umfassenden Lieferengpässe für Impfstoff e.14 Diese Haltung der Behörden wirft Fragen auf und lässt Raum für Spekulationen. Besteht vielleicht gar keine Infektionsgefahr? Sind eventuell die Flüchtlinge trotz fehlender Impfpässe großteils geimpft? Gemäß den offi ziellen Aussagen der Weltgesundheitsorganisation hat beispielsweise Syrien, aus dem derzeit die meisten Flüchtlinge einreisen, durchaus einen mit Deutschland vergleichbaren Impfkalender und auch hohe Impfraten.15 Das dürfte den deutschen Gedurchgeimpft sind. Weitere Impfungen sind nicht nur unnötig, sondern auch kostenintensiv und erhöhen das Nebenwirkungsrisiko. – 36 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 drücklich empfohlenen Impfstoff en sehr gelegen, weil dadurch die ohnehin überfl üssigen Impfungen ausfallen und damit auch keine Kosten verursachen. Falls diese Hypothesen stimmen, muss das Verhalten der Gesundheitsbehörden und allen voran der Impfkommission STIKO scharf verurteilt werden. Das ohnehin durch massive Interessenskonfl ikte bereits getrübte Vertrauen nimmt weiter Schaden.16,17 Fußnoten: 1 “Familiennachzug: Aigner erwartet bis zu sieben Millionen Flüchtlinge”, Augsburger Allgemeine online vom 7. Okt. 2015 2 Sozialministerium Bayern (online), “Asylsozialpolitik, Zahlen und Fakten” 3 RKI, Epidemiologisches Bulletin (EpiBull) 41/15 4 “Welche Flüchtlinge jetzt nach Deutschland kommen”, Rheinische Post online vom 16. Sept. 2015 5 Gelbe Liste, Stand Oktober 2015 6 Gelbe Liste, Stand Oktober 2015 7 „Neue Vergütung für Schutzimpfungen ab 2014“, Kassenärztliche Vereinigung Nordrhein online vom 17. Juni 2014 8 “WHO vaccine-preventable diseases: monitoring system. 2015 global summar”, Syrian Arab Republic, WHO online, Stand vom 8. Sept. 2015 9 EpiBull 34/15 10 EpiBull 41/15 11 EpiBull 41/15 12 http://www.rki.de/DE/Content/ Kommissionen/STIKO/Lieferengpaesse/Lieferengpaesse_node. html 13 http://www.pei.de/DE/ arzneimittel/impfstoff -impfstoff e-fuer-den-menschen/lieferengpaesse/informationen-lieferengpaesse-impfstoff e-inhalt.html 14 http://www.pharmazeutische-zeitung.de/index.php?id=3 2609 15 http://apps.who.int/ immunization_monitoring/ globalsummary/countries?countrycriteria[country][]=SYR&commit=OK 16 http://www.taz.de/!5191620/ 17 https://www.transparency. de/2009-09-14-Schweinegrippe.1494.0.html Lieferengpässe bei Impfstoffen und was die STIKO empfi ehlt Die aktuellen Impfempfehlungen der STIKO für Flüchtlinge sind derzeit wegen massiver Lieferengpässe gar nicht umsetzbar. sundheitsbehörden bekannt sein (siehe Tabelle Seite 34 + 35). Da die Flüchtlinge jedoch in der Regel keinen Impfpass haben, gelten sie laut den Vorgaben der STIKO als ungeimpft, sind es jedoch nicht. Es könnte also durchaus sein, dass das Hauptproblem bei den Flüchtlingen nicht die fehlenden Impfungen, sondern die fehlenden Impfpässe sind. Hier kämen dann die Lieferengpässe bei den aus- Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 37 – impf-report Nr. 109 4. Quartal 2015 Im August 2012 bemerkte ich beim Kampfkunsttraining eine Ausdauerschwäche des rechten Trizeps. Da ich über 30 Jahre Kampfsport gemacht hatte und in jungen Jahren dies als Leistungssport betrieben hatte, konnte ich mir diese Schwäche nicht erklären. Im Laufe der nächsten drei Monate kamen mehrere Muskelschwächen hinzu, Rückenmuskulatur, rechts und links, Schultermuskulatur und im November ist mir dann beim Treppensteigen das rechte Bein eingeknickt, da ich im Oberschenkel plötzlich keine Kraft mehr hatte. Auch im Krafttraining bemerkte ich an der linken Schultermuskulatur eine starke Schwäche: Ich konnte an der Schulterpresse gerade so mit 15 kg zwei Wiederholungen machen. Daraufhin ging ich zum Neurologen, der mich dann im Februar 2013 ins Bürgerhospital nach Stuttgart überwies. Nachdem man mich dort eine Woche lang intensiv untersucht hatte, bekam ich vom Oberarzt die Diagnose ALS gestellt. Der Oberarzt meinte, ich hätte noch maximal ein Jahr zu leben. Mit dieser Aussage wurde ich dann nach Hause geschickt. Sie gaben mir eine Packung RILUTEK Tabletten, die – wiederum Aussage des Oberarztes – anscheinend auch nicht bei Jedem wirken würden und nur eine max. Lebensverlängerung von drei Monaten brächten. Ich bekam keinerlei Tipps bezüglich einem Therapeuten oder sonst irgendeine Hilfe angeboten. Danach wurde ich von einem Hausarzt sechs Wochen krankgeschrieben und hatte starke Depressionen. In den ersten sieben Nächten konnte ich nicht schlafen, somit ging ich zum Hausarzt und wollte von ihm Schlaftabletten verschrieben bekommen. Nachdem er meine Diagnose gelesen hatte, fragte er mich, ob ich Antidepressiva nehmen würde: Ich bejahte. Daraufhin meinte er, ich solle am Abend eben sechs Stück nehmen, dann könnte ich mit Sicherheit schlafen. Seiner Meinung nach würde ich in max. 1,5 Jahren tot sein. Er hat mir keine Schlaftabletten verschrieben, auch nichts zur Beruhigung. Ich hatte das Gefühl, er wollte sein Budget nicht unnötig belasten. Auch von einem zweiten Hausarzt wurde ich abgewimmelt, ebenfalls mit der Aussage, ich hätte noch maximal 1-1,5 Jahren zu leben. Von meiner Schwester bekam ich dann den Tipp, ich soll mich an Dr. Mutter in Konstanz wenden. Sie war auf einer Veranstaltung der OPEN MIND ACADEMY gewesen und hatte einen Vortrag von Dr. Mutter angehört. Glücklicherweise wurde mir über die Notfallwarteliste über einen frei werdenden Platz ein Termin bei Dr. Mutter zugesagt. Dr. Mutter meinte, ich hätte eine maximal 50%ige Überlebenschance. Ich müsse allerdings „richtig Gas geben“. Seine Kompetenz und nüchterne überzeugende Art, wie er die Krankheit und die Therapie gesehen hat, hat mir Hoff nung gegeben. Er verordnete mir unzählige Mikronährstoff e, die ich selbst im Internet besorgen musste. Das Erste, was ich auf laut Dr. Mutter tun musste, war meine kompletten Ober- und Unterkiefer metallfrei zu machen. Ich hatte früher 16 Amalgam Füllungen, die ich mir vor 20 Jahren ausbohren ließ (ohne Koff erdamm) und hatte nun stattdessen viele Kronen, Inlays, gewurzelte Zähne. Auch hatte ich fünf Entzündungen im Kieferbereich, die bisher nie ein Zahnarzt bemerkt hatte. Ich ließ dann sofort die komplette metallfreie Sanierung in der Zahnklinik bei Dr. Scholz machen. Nach ein paar Tagen bemerkte ich, dass mein rechter Oberschenkel nicht mehr einknickte. Die Kraft war wieder da, und dies wenige Tage nach der Zahnbehandlung! Gleich danach begann Dr. Mutter mit der Ausleitung per DMPS (Dimercaptopropansulfonsäure zur Schwermetall-Entgiftung). Ich bekam wöchentlich einmal DMPS-Infusion und einmal DMPS subkutan. Bis heute hab ich ca. 73 DMPS-Behandlungen von Dr. Mutter bekommen und bekomme heute noch alle 25 Tage eine DMPS oral. Die DMPS-Infusionen hat meine Hausärztin vorgenommen, somit konnte ich mir die wöchentliche Fahrt nach Konstanz ersparen. Nach der Zahn-OP musste ich biologisch angebaute Rohkost zu mir nehmen, in den ersten 3 Monaten waren es 60 %, nach ein paar Monaten wurde es von Dr. Mutter auf 80% erhöht. Ich habe viele Wildkräuter (z. B. Girsch, Brennessel) zum Salat-Smoothie hinzugemixt. Die anderen 20 % waren glutenfreie Amytrophe Lateralsklerose (ALS): Ein Heilungsbericht Die Amytrophe Lateralsklerose (ALS) ist eine gefürchtete degenerative Erkrankung des motorischen Systems – und gilt nach Ansicht der Schulmedizin als unheilbar. Patienten mit dieser Diagnose bekommen oft von ihren Ärzten zu hören, dass sie nur noch Monate oder wenige Jahre zu leben hätten. Doch aus alternativmedizinischer Sicht gibt es durchaus Hoffnung auf Besserung oder gar Heilung, wie dieser authentische Fallbericht zeigt. Wir danken Dr. med. Joachim Mutter für die Überlassung dieses Berichts und dem Patienten für sein Einverständnis zum Abdruck. Anonym, am 7. Juni 2015 – 38 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Lebensmittel, die ich zu mir genommen habe. Lebensmittel vom Bäcker, Metzger, Milchprodukte, Obst habe ich weggelassen. Auch hatte ich einige Termine bei H. Plothe, einem Heilpraktiker. Dieser hatte bei seiner Untersuchung festgestellt, dass ich auf Titan allergisch reagieren würde. Ich hatte mir vor 25 Jahren beide Kreuzbänder gerissen, diese wurden operiert und mit Titanschrauben und Titanhaken wieder befestigt. Dr. Mutter meinte, dass Titan im Kieferbereich sehr gefährlich sei, je weiter dieser aber davon entfernt ist, desto geringer sei die Gefahr. Ich dachte mir, wenn ich meinen Körper aufräume, dann konsequent, somit ließ ich mir dann im Krankenhaus in Markgröningen einen Termin geben. Der dortige Oberarzt weigerte sich strikt, mir die Titanschrauben zu entfernen, da das Kniegelenk i. O. sei und schickte mich wieder nach Hause. Er glaubt an keinen Zusammenhang zwischen Titanschrauben und der ALS. Daraufhin fragte ich bei Dr. Mutter nach, der mir den Rat gab, einen Bluttest in einem Labor machen zu lassen. Das Ergebnis war, dass ich laut Labor allergisch auf Titan reagiere, d. h. mein Immunsystem allergisch darauf reagiert. Aufgrund diesem Attest stimmte dann der Oberarzt zähneknirschend der OP zu und entfernte mir chirurgisch beidseitig beide Titanschrauben und Titanhaken. Auch hatte ich mir 2009 ein schwarzes, großes Tattoo am Unterarm stechen lassen, das mir allerdings nie Probleme bereitet hatte. Ich fragte im Tattoo-Studio nach, ob in der Tattoo-Farbe eventuell Schwermetalle enthalten sein könnten. Der Inhaber meinte, seine Farben seien rein, da er sie vom Großhändler beziehe und sie der Norm entsprechen würden. Dr. Mutter riet mir, eine Biopsie machen zu lassen, erst dann könne man Klarheit haben. Daraufhin ließ ich eine Biopsie durchführen und von einem Labor untersuchen. Das Ergebnis war, dass die Tattoo-Farbe giftige Substanzen enthielt, wie z. B. Aluminium, Arsen, Zink und Blei. Ich ließ mir dann das Tatoo chirurgisch in einem Krankenhaus in Stuttgart entfernen, die OP-Kosten musste ich allerdings selbst bezahlen. Die Krankenkasse hat diese Kosten nicht übernommen. Während dieser Zeit sind keine neuen Muskelschwächen hinzugekommen. Im Gegenteil, die Muskelschwächen sind besser geworden. Nach einem dreiviertel Jahr hatte ich über 10 kg abgenommen, aber ich fühlte mich in keinster Weise schlapp oder antriebslos. Im Gegenteil, ich war fi t und hatte dann wieder mit Krafttraining angefangen. Heute, zwei Jahre und drei Monate nach der Diagnose, hab © Henrie – fotolia.com Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 39 – impf-report Nr. 109 4. Quartal 2015 ich ca. 10 kg an Muskelmasse zugenommen. Ich gehe eine Stunde joggen und im Krafttraining habe ich stark an Kraft zugelegt. Zum Vergleich: Dezember 2012: 15 kg -> 2 Wiederholungen an der Schulterpresse. Mai 2015: 100 kg -> 3 Sätze mit je 12 Wiederholungen an der Schulterpresse. Auch habe ich an allen Muskeln eine große Kraftsteigerung bekommen. Im Oktober 2014 ließ ich dann auf Anraten von Dr. Mutter eine erneute Nadelmyographie bei meinem Neurologen machen. Das Ergebnis war, dass er keinerlei Anzeichen für eine ALS mehr feststellen konnte. Die Messung ergab keinerlei pathologische Spontanaktivität! Er meinte, mein ganzer Krankheitsverlauf würde einer ALS/ Motoneuronerkrankung widersprechen. Seine Aussage war: Bild und Verlauf widersprechen der Annahme einer progressiven Motoneuronerkrankung/ALS. Er hatte schlichtweg keine Erklärung für die Heilung. Was ich noch habe, sind leichte Muskelzuckungen, die sich aber in den letzten fast 2,5 Jahren deutlich abgebaut haben, laut Neurologen unspezifi sch sind, demnach gutartig sein können und für sich allein keine prognostische Wertigkeit besitzen. Ich bemerke allerdings, dass diese bei Stress stärker und im entspannten Zustand sehr schwach sind. Ich hatte bis kurz vor dem Ausbruch der Krankheit sehr viele Impfungen bekommen, eigentlich alle, die man so als Kind bis zum Erwachsenen im Allgemeinen bekommt. Auch Impfungen gegen FSME, Tetanus usw. Dr. Mutter meinte, in den Impfstoff en kann auch Quecksilber in Spuren und meist auch Aluminium enthalten sein. Dieses kann die Giftigkeit von Quecksilber auf Nervenzellen erhöhen. Ich habe mich darüber belesen und bin für mich persönlich zu dem Schluss gekommen, dass ich zukünftig sicherheitshalber keine Impfungen an mir durchführen lassen werde. Auch habe ich von Anfang an, bis heute, psychologische Hilfe bei einer Therapeutin in Anspruch genommen, die mir sehr gut getan hat. Die Krankenkassen haben mir die Therapiekosten nicht ersetzt. Ich wurde von der Techniker-Krankenkasse abgeworben, mit der mündlichen Zusage des Außendienstmitarbeiters, dass die TK meine Therapiekosten übernehmen würde. Nachdem ich dann gewechselt hatte, änderten sie plötzlich ihre Meinung und meinten, sie würden dies doch nicht bezahlen, da die Therapeutin auch als Heilpraktikerin tätig sei. Anmerken möchte ich, dass die Krankenkassen (ich war bei zwei verschiedenen Krankenkassen) keinerlei Kosten der Behandlung von Dr. Mutter, der Zahnbehandlung, der Mikronährstoff e, die Kosten der Ausleitung (Arztkosten für die Infusionen) oder der Tattooentfernung bezahlt hatten. Auch wohnte ich zum Zeitpunkt der Diagnose in der Einfl ugschneise des Flughafens. Aufgrund des Elektrosmogs, wie z. B. der Radarstrahlen, bin ich auf Anraten des Buches „Lass dich nicht vergiften“ von Dr. Mutter wieder in meine Eigentumswohnung, die ca. 60 km vom Flughafen entfernt liegt, eingezogen. Ich ließ dann dort eine Netztrennspannung des Schlafzimmers vornehmen und besorgte mir einen Abschirmvorhang für die Hochfrequenzstrahlung. Au- ßerdem verwende ich kein Handy, Schnurlostelefon oder WLAN. Diese Strahlung hat sicher keinen positiven Einfl uss auf meine Nerven. Gestern, den 18. Mai 2015, war ich nochmals beim Neurologen zur Routineuntersuchung. Seine Aussage war dieses Mal, dass das Bürgerhospital in Stuttgart bei mir leider eine Fehldiagnose erstellt hatte, es sei eher eine virusbedingte Entzündung gewesen, die wiederum eine Schulter-Myographie mit einer Lähmung verursacht hätte. Bei meinem Krankenhausaufenthalt 2013 wurde aber eine Rückenmarkspunktion gemacht, bei der komischerweise keinerlei Entzündungen festgestellt worden sind! Auch stand in meinem Bericht des Bürgerhospitals von 2013 drin, dass mein „zweites Motoneuron irreversibel defekt sei“. Auf meine Frage wie das sein könnte, dass ich jetzt körperlich topfi t sei, meinte er, er wisse nichts von einem irreversiblen zweiten Motoneuron! Anmerken möchte ich noch, dass das ganze Gesundheitssystem, die Ärzte eingeschlossen, bei der Diagnose ALS keinerlei Interesse gezeigt haben, warum ich wieder geheilt worden bin. Es hat niemanden interessiert. Ich wurde im Mai 2015 vom ALS-Zentrum Ulm (RKU) ein zweites Mal gefragt, ob ich an einer ALS-Studie teilnehmen würde. Nachdem sie erfahren hatten, wie es mir geht und irgendwie an den Bericht meines Neurologen gekommen waren, sagten sie, da es ja eh eine Fehldiagnose war, würde ich jetzt aus der Studie rausfallen. Sie haben nicht mal gefragt, wie es dazu gekommen ist, es hat sie schlichtweg nicht interessiert. Nachdem ich den Namen Dr. Mutter erwähnt hatte, wurde ich abgewimmelt. Man kämpft auf der einen Seite gegen die Krankheit, auf der anderen Seite auch gegen die Ärzte und Krankenkassen. Heute, nach fast 2,5 Jahren kann ich sagen, dass nur die Therapie von Dr. Mutter mir das Leben gerettet hat. Ich bin in einer sehr guten körperlichen Verfasssung, habe keinerlei Muskelprobleme mehr und ich kann bestätigen, dass ich dank Dr. Mutter von einer laut Schulmedizin „tödlichen, unheilbaren Krankheit“ geheilt worden bin. Anmerkung der Redaktion: Wenn Sie ebenfalls von ALS oder ähnlichen chronischen Erkrankungen betroff en sind und an einer seriösen Zweit- oder Drittmeinung und Vermittlung eines Therapeuten interessiert sind, empfehle ich Ihnen das Therapeutennetzwerk „Frankfurter Consilium“, das von Ralf Kollinger moderiert wird. Weitere Infos fi nden Sie unter http://www.ralf-kollinger. de. Wir empfehlen ihn deshalb, weil er unserer Meinung nach möglicherweise den besten Überblick über seriöse Alternativ-Therapien und Therapeuten in ganz Deutschland besitzt. – 40 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Am 30. Januar 2014 zeigte 3sat eine Dokumentation mit dem reißerischen Titel „Impfen – Nein Danke?“. Die Sendung zeichnet sich aus durch Unausgewogenheit und schlechte Recherche. Es kommen fast ausschließlich Impff unktionäre und –lobbyisten zu Wort. Als Alibi-Häppchen dienen kurze Ausschnitte aus einem Interview mit unserem Vereinsmitglied Martin Hirte. „Impfen – Kein Problem“ wäre der treff endere Titel des Beitrags gewesen. Hier einige Beispiele für die Tendenziösität: Die ausführliche Darstellung der Herstellung von Grippe-Impfstoff en bei GlaxoSmithKline mit Peter Schu, Geschäftsführer des Unternehmens, suggeriert die Unumstrittenheit der Grippe-Impfung. Die Sendung verliert kein Wort über Zweifel an der Wirksamkeit der Grippeimpfung und über die Problematik des Industriesponsorings von Impfstudien. Man hätte gerne einen Wissenschaftler etwa des unabhängigen Cochrane-Instituts vor der Kamera gesehen, und nicht einen Vertreter der Industrie. GlaxoSmithKline war immerhin 2012 in den USA Spitzenreiter bei Strafzahlungen wegen der Verheimlichung von Medikamenten-Nebenwirkungen. Klaus Schlüter, Geschäftsführer von Sanofi Pasteur, darf vor laufender Kamera die „Impfmü- digkeit“ beklagen, die durch die „Pandemiediskussion“ während der „Schweinegrippe“ 2009 entstanden sei. Als sei diese Diskussion die Ursache gewesen, und nicht der Ärger über die Impfl obbyisten in den nationalen und internationalen Gremien. Die Sendung übergeht diese Hintergründe völlig. Darüber hätte man aber gerne etwas gehört, etwa von einem Mitarbeiter des Arzneitelegramms oder von Transparency International*. Jan Leidel, Vorsitzender der STIKO, bezeichnet den Schweinegrippeimpfstoff Pandemrix, der Hunderte von Kindern und Jugendlichen für ihr Leben lang geschädigt hat, als „gut“. So eine – vielleicht nur ungeschickte – Bemerkung in der Sendung zu lassen und nicht herauszuschneiden ist ein grober Fauxpas der Redaktion. Impfkritische Eltern werden in dem Film verunglimpft: Sie stünden der Schulmedizin „grundsätzlich skeptisch“ gegenüber, seien also so etwas wie Kritiker um jeden Preis, und seien mehr oder weniger „verantwortungslos“. Es wird gemutmaßt, „Impfskepsis“ oder „Impfverweigerung“ stammten aus einer Art verzerrten Wahrnehmung. Weiterhin wird suggeriert, Impfkritiker würden grundsätzlich a l l e Impfungen ablehnen. Es wird in der Sendung berichtet, gebildete Eltern seien impfkritischer eingestellt. Es wird aber nicht den Ursachen nach- Öffentliche Stellungnahmen von differenziert impfenden Ärzten Es gibt sie noch, die Kinder- und Hausärzte, die nicht blind jedem neuen Impf-Hype folgen, der durch die Massenmedien getrieben wird, sondern zusammen mit ihren Patienten bzw. deren Eltern sorgfältige individuelle Nutzen-Risikoabwägung anbieten. Und einige davon haben noch nicht aufgegeben, sich gegen die in der Regel völlig einseitige und industrienahe Berichterstattung in den Massenmedien zu stemmen. Dazu gehören vor allem auch die beiden Münchner Kinderärzte Martin Hirte und Steffen Rabe. Beide sind u. a. auch aktive Mitglieder des Ärzteverbandes „Ärzte für individuelle Impfentscheidung e. V.“ (www.individuelle-impfentscheidung. de). Wir danken ihnen – und Dr. Harald Hüther – herzlich für die Genehmigung, einige ihrer Leser- bzw. Zuschauerbriefe im impf-report abzudrucken. 3sat verunglimpft impfkritische Eltern von Dr. med. Martin Hirte Dr. med. Martin Hirte ist seit 1990 niedergelassener Kinderarzt mit Schwerpunkt Klassische Homöopathie in München und Mitglied eines homöopathischen Qualitätszirkels. Er ist Jahrgang 1954 und in Bamberg (Oberfranken) und Straubing (Niederbayern) aufgewachsen. Nach dem Medizinstudium in Regensburg und München absolvierte er die Facharztausbildung in Kinderheilkunde ebenfalls in Regensburg und München (Krankenhaus Harlaching). Er ist verheiratet und Vater von vier Kindern. Martin Hirte ist in Fachkreisen und bei vielen Eltern vor allem durch sein Buch „Impfen, Pro und Kontra“ bekannt, das als Standardwerk einer differenzierteren Impfentscheidung gilt. Darüber hinaus nimmt er als Mitglied der „Ärzte für individuelle Impf entscheidung e. V. “ immer wieder öffentlich Stellung zu impfrelevanten Themen. Seine Webseite: http://www.martin-hirte.de Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 41 – impf-report Nr. 109 4. Quartal 2015 gegangen; auch nicht der Frage, warum mehr als ein Drittel aller Eltern ihre Kinder nicht nach STIKO-Empfehlung impfen lassen. Es wird nur die Behauptung aufgestellt, das Internet sei mehr oder weniger an allem schuld. Es wird behauptet, das Masernproblem in den USA sei gelöst. Nicht erwähnt wird, dass es dort 2013 mindestens 186 Masernfälle gab (Pediatrics 2014). Die USA sind also beileibe nicht frei von Masern. Es wäre auch einen Kommentar wert gewesen, dass Kinder, die gemäß STIKO-Empfehlung schon mit 11 Monaten geimpft werden, besonders häufi g den Schutz wieder verlieren (De Serres 2012) und damit die Achillesferse des Impfprogramms bilden. Es wird, wie in jeder Sendung über Masern, ein Fall der tödlichen Masernspätfolge SSPE ausführlich dargestellt. Solchen Fällen könnte man ebenso Einzelfälle von Kindern gegenüberstellen, die durch eine Impfung mutmaßlich geschä- digt wurden oder tödliche Komplikationen erlitten. Die „tatsächlichen Fallzahl en“, die belegen sollen, die Masernkrankheit würde 1000mal häufi ger Schäden hervorrufen als die Impfung, sind völlig aus der Luft gegriff en. Es gibt unterschiedlichste Zahlen, je nach Schätzungen und Intentionen* des jeweiligen Autors, aber ein Verhältnis von 1:1000 lässt sich mit keiner professionellen Analyse belegen. Es wird unkommentiert dargestellt, die STIKO-Empfehlungen würden verlässlich auf der sogenannten Evidence Based Medicine* beruhen. Daran gibt es berechtigte Zweifel, denn sie berufen sich nahezu ausschließlich auf Studien von Pharmaherstellern, und über deren Problematik gibt es inzwischen viele kritische Studien (z. B. von Schott). Vor allem an die Sicherheits- überprüfung von Impfstoff en werden nur sehr geringe Anforderungen gestellt. Positive Auswirkungen von Krankheiten (wie z. B. Mumps oder die Windpocken) auf die Langzeitgesundheit werden bei den Empfehlungen gar nicht berücksichtigt; ebenso wenig die Folgen des Verschiebens von Krankheiten wie Masern, Windpocken, Mumps oder HPV in höhere Altersgruppen. Der Verfassungsrechtler Rüdiger Zuck hält die Verlautbarungen der STIKO für „in verfassungswidriger Weise unvollständig“, denn eine Risikoabschätzung sei „auf ihrer Grundlage weder für den Impfl ing noch für den Arzt möglich“. Herrn Zuck hätte man gerne in dieser Sendung gehört. Die Arbeit der STIKO ist nicht transparent, wie unkommentiert dargestellt wird: Die Sitzungen sind nicht öff entlich, die Sitzungsprotokolle wurden bis vor Kurzem nicht veröff entlicht (erst ab Nov. 2012), die Berufungskriterien der Mitglieder sind nicht veröff entlicht. Etliche STIKO-Mitglieder deklarieren relevante Interessenkon- fl ikte. Das ist bei einem Gremium mit so weitreichender Befugnis inakzeptabel. In einer Verlautbarung der DEGAM (Deutsche Gesellschaft für Allgemeinmedizin) heißt es: „Übereilte Einführungen von Impfungen dürften zudem auch zu Spekulationen beigetragen haben, die STIKO sei in ihren Empfehlungen nicht allein von sachlich-wissenschaftlichen Interessen geleitet. Einige nachgewiesene Industrie-Verfl echtungen von Mitgliedern der STIKO verstärkten diesen Eindruck“. Warum wurde von der DEGAM niemand interviewt? Warum niemand von Transparency International? Es wird dargestellt, dass Krampfanfälle nach Impfungen durch einen Gen-Defekt verursacht werden, die Schuld also quasi beim Kind liegt. Auch der Fall Wakefi eld wird als Beleg dafür präsentiert, dass es eigentlich keine echten neurologischen Impfschäden gibt. Die vielen Meldungen beim Paul-Ehrlich-Institut zu neurologischen Erkrankungen nach Impfungen – 20 % aller gemeldeten Impfreaktionen – sprechen eine andere Sprache. Es kam jedoch niemand zu Wort, der mit solchen Fällen professionell zu tun hat. Es wird suggeriert, das Meldesystem für Impfnebenwirkungen des Paul-Ehrlich-Instituts sei vollständig und verlässlich. Wahrscheinlich werden jedoch höchstens 10 Prozent selbst der schweren Fälle gemeldet. Auch der in der Sendung auftretende Kinderarzt hat nach eigenen Angaben noch nie einen schweren Fall gesehen oder gemeldet – nach unserer Erfahrung eine nicht nachzuvollziehende Aussage. Der Vorsitzende der Kinder- ärztlichen Gesellschaft darf unkommentiert zum Besten geben, alle Impfungen würden sich gegen Krankheiten richten, die „für die Kinder bzw. die Betroff enen hochdramatisch, teilweise sogar mit Todesfolge verlaufen können“. Kein Wort dazu, dass er Windpocken, Mumps oder Rotavirus-Durchfall nicht gemeint haben kann. Werbung von einem Industrievertreter für die HPV-Impfung machen zu lassen, ist schlechter Stil. Man muss im Grunde eine Deklaration der Interessenkonfl ikte der verantwortlichen Redakteure fordern. * Worterklärungen Intention Absicht, Vorhaben (lat. intentio „Spannung, Aufmerksamkeit, Achtsamkeit“) Transparency International (TI) weltweit agierende Nichtregierungsorganisation (NGO) mit Sitz in Berlin, die sich in der nationalen und internationalen volks- und betriebswirtschaftlichen Korruptionsbekämpfung engagiert, gegründet 1993 in Berlin vom ehemaligen Direktor der Weltbank für Ostafrika, Peter Eigen und Mitstreitern aus aller Welt. TI verfügt über mehr als 90 nationale Ableger, zu denen auch TI Deutschland gehört. – 42 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Mit keiner Impfstrategie wird es gelingen, die Masern auszurotten von Dr. med. Martin Hirte In der Rubrik „Außenansicht“ erschien am 09.03.2015 in der Süddeutschen Zeitung in gekürzter Form folgender Gastkommentar: Es ist wie in einem Tollhaus: Politiker, Ärztevertreter und Medien überbieten sich mit Forderungen nach einer Impfpfl icht für Masern; Berliner Eltern sollen mit ihren Säuglingen zu Hause bleiben; Berlin-Reisen werden storniert. Manche private Kinderkrippen haben nicht verstanden, dass es nur um Masern geht, und verhängen gleich eine Impfpfl icht für alles, vorsorglich auch für die Geschlechtserkrankung Hepatitis B. Warum diese Panik? Masern gibt es seit Menschengedenken, und wir hatten uns relativ gut mit dieser Krankheit eingerichtet. Noch Anfang der Siebzigerjahre hatte jeder mit spätestens zehn Jahren die Masern hinter sich. Es gab daher kaum Fälle bei Erwachsenen, und auch selten bei Säuglingen, die durch die hohen Antikörperspiegel ihrer Mütter geschützt waren. Entsprechend selten traten Komplikationen auf. Dennoch wurden Hirnentzündungen und tödliche Verläufe in der Häufi gkeit von damals (1:10.000) zunehmend inakzeptabel. Durch die Masernimpfung nach 1972 sanken die Erkrankungen nachhaltig, sie liegen seit 2004 bis auf wenige Ausnahmen zwischen 500 und 2000 pro Jahr. Todesfälle gibt es nur noch vereinzelt, am ehesten bei Säuglingen und Erwachsenen. Gegenwärtig sind 97 Prozent der Grundschüler einmal und 92 Prozent zweimal gegen Masern geimpft – von Impfmüdigkeit also keine Spur. Mit Engelszungen und Aufklärung könnte innerhalb weniger Jahre das Ziel erreicht werden, die Masern weitgehend einzudämmen, ohne Bußgeld und Zwangsimpfung. Ich arbeite in meiner Praxis daran mit. Klar ist aber: Mit keiner Impfstrategie wird es gelingen, die Masern auszurotten. Es gibt nicht nur Impfgegner, sondern auch Menschen, bei denen die Impfung nicht wirkt. Der Anteil beider Gruppen dürfte etwa gleich hoch sein und zusammen annähernd zehn Prozent ausmachen. Selbst wenn man also 95 Prozent der Bevölkerung zweimal impft, werden zehn Prozent jedes Jahrgangs ungeschützt erwachsen und können bei Masernkontakt erkranken. Es ist zudem illusorisch, in allen Ländern der Welt 95 Prozent der Bevölkerung zweimal zu impfen: Armut, Bürgerkriege und failed states wird es immer geben. Reisende, Flüchtlinge oder Migranten (wie eben in Berlin) tragen das Virus um die Welt. Es kann sogar in einer weitgehend immunen Bevölkerung jahrelang unter- und dann wieder auftauchen. Wir können die Masern also höchstens eindämmen. Die Krankheit gehört zum menschlichen Schicksal wie Erdbeben oder Unwetter. Die Frage ist nur: Wie weit gehen wir in unserem Sicherheitsbedürfnis, und wieviel Freiheit setzen wir dafür aufs Spiel? Stellen wir uns die Impfpfl icht vor: Was geschieht, wenn Eltern sich trotz Bußgeld weigern, ihr Kind impfen zu lassen? Kommt dann die Polizei und reißt ihnen ein schreiendes Kleinkind aus den Armen? Was würde das für unser demokratisches Selbstverständnis bedeuten? Was sind die langfristigen Nebenwirkungen? In Westdeutschland haben wir uns erst zwei Jahrzehnte nach dem Krieg vom Muff des Obrigkeitsstaates freigekämpft. Das Vermächtnis des Kaiserreichs mit seinem rigorosen Reichsimpfgesetz hat lange fortgewirkt, ebenso das Dritte Reich mit seinen Massenimpfungen als Inszenierung der „Volksgemeinschaft“. Noch in den Sechzigerjahren sprachen Politiker vom Primat des „Volkskörpers“ über den Körper des Einzelnen. Die demokratische Zivilgesellschaft setzt auf Freiheit und Selbstbestimmung. Dazu gehört die freie, informierte und individuelle Impfentscheidung, gestützt durch Beratung. Ein Fortschritt, den wir uns nicht nehmen lassen dürfen. Doch wir müssen gar nicht die Verfassung bemühen – Würde des Menschen, körperliche Unversehrtheit, Recht auf Selbstbestimmung –, wenn es um die Akzeptanz von Impfgegnern geht. Nein, wir brauchen diese Menschen, wir brauchen Diskussion, wir brauchen Nonkonformisten. Ein Impfgegner hat durchgesetzt, dass die Ständige Impfkommission (STIKO), die bis dahin im vordemokratischen Dunkeln arbeitete, ihre Protokolle ver- öff entlichen muss. Impfkritische Stimmen gaben den Ausschlag dafür, dass die STIKO Impfstoff e nicht mehr unbesehen durchwinkt. Impfskepsis ist kein böser Wille. In keinem anderen Land Europas sind so viele Impfungen so früh empfohlen wie bei uns. Ein ordentliches ärztliches Beratungsgespräch ist da nicht mehr möglich. Impfstoff e werden im Eilverfahren zugelassen, Risiken sind nicht untersucht oder werden nicht kommuniziert. Der Verfassungsrechtler Rüdiger Zuck hält die STIKO-Empfehlungen für verfassungswidrig: Die Abwägung von Risiko und Nutzen sei weder für den Impfl ing noch den Arzt möglich, der Staat verstoße deshalb gegen seine grundrechtlichen Schutzpfl ichten. Im Grunde muss die pharmanahe und off ensichtlich überforderte STIKO aufgelöst und stattdessen ein „Amt für Prävention“ eingerichtet werden, dessen Aufgabe es wäre, Impfungen professionell und ohne Einfl uss der Industrie einzuschätzen und gegen andere Maßnahmen abzuwägen. Wer Impfzwang fordert, müsste viel eher anderswo Zwang fordern: Einschränkung von Autofahrten; Verbot von Tabak und Alkohol; Zwang zum Stillen, denn das steigert die Lebenserwartung des Kindes. Wollen wir eine Gesundheitsdiktatur? Dieselben Politiker, die eine Impfpfl icht fordern, schießen durch den neoliberalen Umbau des Gesundheitssystems die öff entlichen Krankenhäuser sturmreif und betreiben mit Freihandelsund Dienstleistungsabkommen den Ausverkauf an Finanzhaie und Investoren – mit absehbar verheerenden Auswirkungen auf Arbeits- Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 43 – impf-report Nr. 109 4. Quartal 2015 Leserbrief an das Deutsche Ärzteblatt zum dort erschienenen Artikel: Durch impfungsraten bei der Schulein gangsuntersuchung 2012: Deutsch landweite Erhebung auf Ebene der Landkreise und kreisfreien Städte. Dtsch Arztebl Int 2014; 111(46): 788-94 Sehr geehrte Damen und Herren, in dem Beitrag von Weigel et al. wird von unzureichenden „Durchimpfungsraten“ und der Notwendigkeit von „Aufklärungskampagnen“ gesprochen – obwohl die ermittelten Raten größtenteils weit über 90 Prozent liegen. Das erinnert an die Dystopie* einer Gesundheitsdiktatur, wie sie Juli Zeh in ihrem lesenswerten Roman „Corpus Delicti“ an die Wand malt, und wie sie jetzt in Form der elektronischen Kontrolle von Fitness, Ernährung und Lebensstil („Generali-Modell“) durch die neoliberale Hintertür auf uns zukommt. „Eine hohe Durchimpfungsrate in der Bevölkerung zu erreichen ist erstrebenswert“: Von einem Institut, das sich nach eigenen Angaben der Prävention und Gesundheitsförderung verschrieben hat, würde ich mir hier mehr Diff erenzierung wünschen. Jede einzelne Impfempfehlung muss sich, selbst wenn sie von einer demokratisch besser legitimierten, nicht hinter verschlossenen Türen agierenden und nicht mit Interessenkonfl ikten belasteten Impfkommission stammen würde, immer wieder in Frage stellen lassen. Als impfender Arzt frage ich mich etwa, welches autoimmune Risiko ich Säuglingen zumute, wenn ich sie gegen Hepatitis B, einer Geschlechtserkrankung (!) impfe. Ich würde gerne auch mehr über das Nutzen-Risiko-Profi l der Keuchhustenimpfung wissen, die bekanntermaßen schlecht verträglich ist und in der Wirksamkeit gegen Null geht (Bertilone 2014, van der Maas 2013). Ich habe Bedenken bei der Mumpsimpfung von Mädchen, wo doch die Mumpserkrankung ihr Risiko von Ovarialkarzinom* senken würde. Und mich interessiert eine einleuchtende Begründung, warum ich Windpocken in der Kindheit verhindern soll, wo wir doch damit der jetzigen Generation mehr Zoster-Erkrankungen* und künftigen Generationen Windpocken im Erwachsenenalter zumuten. Es ist ein Märchen, dass Impfstoff e „vor der Zulassung klinisch geprüft“ und ihre Sicherheit „ständig überwacht“ wird. Es fehlen notwendige Hürden vor der Zulassung, etwa echte Placebo-Studien und die Abklärung von möglichen Langzeitnebenwirkungen. Das passive Meldesystem ist ein völlig unzureichendes Werkzeug zur Postmarketing-Surveillance*, und seit 2008 wurde keine Analyse der Meldedaten mehr veröffentlicht. Mit Recht ist der Verfassungsrechtler Prof. Zuck der Ansicht, die Verlautbarungen der STIKO seien „in verfassungswidriger Weise unvollständig“: eine Risikoabschätzung ist auf ihrer Grundlage weder für den Impfl ing noch für den Arzt möglich. Es ist übrigens nicht allein die „Angst vor unbekannten Nebenwirkungen“, sondern auch vor bekannten Nebenwirkungen, die viele Eltern zurückhaltend macht: in den Beipackzetteln sind genü- gend Impfrisiken aufgeführt, denen man gerne aus dem Weg gehen möchte. Höhere „Durchimpfung“ darf nicht ein Ziel per se* sein. Sie ist auch nicht wünschenswert als primäres Forschungsziel, und schon gar nicht als Forschungsgegenstand von Wissenschaftlern mit enger Bindung an die Industrie. Forschungsgelder sind besser aufgehoben in fundierten Studien zur allgemeinen Gesundheitsprävention („Salutogenese“*), nur fi ndet Höhere Durchimpfung darf nicht ein Ziel per se* sein von Dr. med. Martin Hirte * Worterklärungen Dystopie Schilderung eines negativen zukünftigen Zustands, z. B. der Gesellschaft (grch. dys „schlecht, schwer, schwierig, widrig“ + topos „Ort“) Ovarialkarzinom Eierstockkrebs (lat. ovarium „Eierstock“, zu ovum „Ei“ + karkinos „Krebs“) per se selbstverständlich (lat.) Postmarketing-Surveillance Überwachung nach der Markteinführung (engl.) Salutogenese Gesundheitsentstehung, von lat. salus „Heil, Gedeihen“ Zoster (Herpes Zoster) Gürtelrose (grch. herpein „kriechen“ + zoster „Gürtel“) bedingungen und Patientenversorgung. Keiner weiß, wie viele Opfer das fordern könnte. Auch Ärzte sollten vorsichtig sein mit dem Ruf nach einer Impfpfl icht. Zum einen ist das ein Off enbarungseid: Wir schaffen es nicht, Vertrauen bei Patienten aufzubauen. Zum anderen sorgt unsere Zunft durch ihr Verschreibungsverhalten dafür, dass bestimmungsgemäß (!) eingenommene Medikamente zur dritthäufi gsten Todesursache wurden, wie der dänische Gesundheitsexperte Peter C. Gøtzsche vorrechnet. Aber zurück zum Impfen: Eltern müssen sich nach dem Willen der Bundesregierung künftig von einem Arzt beraten lassen, bevor sie ihr Kind in eine Kita geben. Warum eigentlich erst dann? Impfbeginn ist doch laut STIKO die neunte Lebenswoche! Und warum werden die Eltern verpfl ichtet und nicht der Arzt? Ein ausführliches Impfgespräch mit den Eltern sollte für Ärzte obligatorisch sein, aber auch angemessen vergütet werden. Bisher können Ärzte Impfberatung nur abrechnen, wenn sie dann auch gleich impfen. Es ließe sich vieles besser machen. Aber nicht mit einer Impfpfl icht. – 44 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Gurtpfl icht, Helmpfl icht, Impfpfl icht – Gehpfl icht? von Dr. med. Martin Hirte Leserbrief vom 19.4. 2015 an die Deutsche Apotheker Zeitung betreff end des Editorials in der Ausgabe vom 16. April 2015 S. 3: „Gurtpfl icht, Helmpfl icht, Impfpfl icht“ von Dr. Benjamin Wessinger. Sehr geehrte DAZ-Redaktion, die Impfl icht der Helmpfl icht oder Gurtpfl icht gleichzustellen kann nicht Ihr Ernst sein. Es muss sich doch gerade in pharmazeutischen Kreisen herumgesprochen haben, dass Impfungen im Gegensatz zu einem Motorradhelm oder Sicherheitsgurt mit gravierenden Nebenwirkungen einhergehen können – zwar selten, aber für einen Eingriff an gesunden Kindern doch von einiger Relevanz. Bekannte Ursachen lebensbedrohlicher UAWs (unerwünschte Arzneimittelwirkungen) nach Masernimpfungen sind anaphylaktischer Schock* (durch Gelatine, Hühnerprotein oder Neomycin*), Impfenzephalitis*, Myokarditis* und ungehemmte Virusausbreitung bei angeborener oder erworbener Immunschwäche. Während meiner 30-jährigen kinderärztlichen Tätigkeit habe ich eine schwere Anaphylaxie mit Reanimation, eine schwere asthmatische Reaktion und eine eindrucksvolle Zerebellitis* erlebt. Auf der Website des Paul-Ehrlich-Instituts sind die UAW-Meldedaten* der Masernimpfung für jedermann abrufbar. Sicher ist nicht jede Meldung einer sicheren Impfnebenwirkung gleichzusetzen, andererseits aber stellen die Daten wegen der Meldungs-Resistenz der Ärzteschaft wahrscheinlich nur die Spitze des Eisbergs dar. Allein 2014 wurden dem PEI nach Masernimpfungen acht Fälle von Thrombozytopenie*, sechs Paresen* bzw. Neuritiden* (Guillain-Barré-Syndrom*, Hirnnervenlähmung, Optikusneuritis*), eine Anaphylaxie und ein „ungeklärter“ Todesfall gemeldet. In den letzten vierzehn Jahren wurden beim PEI neunzehn Todesfälle nach einer Masernimpfung registriert. Im selben Zeitraum haben sich nach der Todesursachenstatistik achtzehn Todesfälle durch Masern ereignet. Als in den 1990er Jahren die Polio-Schluckimpfung häufi ger Lähmungserkrankungen (Risiko 1:500.000!) verursachte als das Polio-Wildvirus, wurde sie durch einen Impfstoff mit inaktivierten Polioviren ersetzt. Es wäre nun höchste Zeit, einen weniger riskanten Masernimpfstoff zu entwickeln. Bis dahin müssen wir Kinder- ärzte die Lebendimpfung gegen Masern empfehlen – vor allem wegen des Herdenschutzes für die Erwachsenen und Säuglinge. Diese Altersgruppen machen inzwischen ein Drittel bis die Hälfte der Masernerkrankten aus und haben ein erhöhtes Komplikationsrisiko. Die Freiheit der Impfentscheidung aber muss erhalten bleiben. Der ethische Konfl ikt, ein gesundes Kind zum Wohl anderer einem Impfrisiko auszusetzen, kann nur von den Eltern gelöst werden, im Rahmen einer informierten Impfentscheidung. Was die Einschätzung des Impfrisikos betriff t, stellen allerdings PEI und STIKO die Eltern * Worterklärungen Anaphylaktischer Schock krankhafte Reaktion des Immunsystems auf einen chemischen Reiz, unter Einbeziehung des gesamten Organismus, mit unter Umständen tödlichem Kreislaufversagen (grch. ana „zurück“ + phylassein „bewachen“) Enzephalitis Gehirnentzündung (grch. enkephalos „im Kopf“ + -itis „Entzündung“) Guillain-Barré-Syndrom (GBS) Erkrankung der Nervenwurzeln des Rückenmarks. Verschiedene neurologische Symptome können auftreten, vor allem aufsteigende Lähmungen, ähnlich der Polio (Kinderlähmung). Das Syndrom wurde erstmals im ersten Weltkrieg von den französischen Ärzten Georges Charles Guillain und Jean-Alexandre Barré beschrieben. Myokarditis Herzmuskelentzündung (grch. myos „Muskel“ + kardia „Herz“ + -itis „Entzündung“) Neomycin ein Antibiotikum (ist u. a. auch im MMR-Impfstoff enthalten) Neuritiden Nervenentzündungen (grch. neuron „Sehne, Nerv“ + -itis „Entzündung“) Optikusneuritis Entzündung des Sehnervs (grch. optikos „das Sehen betreff end“ + neuron „Sehne, Nerv“ + -itis „Entzündung“) sich dafür wahrscheinlich keine Drittmittelfi nanzierung. In einer Demokratie dürfen Eltern nicht obrigkeitsstaatlich durch „Kampagnen“ entmündigt werden, sondern sie müssen befähigt („empowered“) werden, für ihre Kinder und die Gesellschaft verantwortliche Entscheidungen im Gesundheitsbereich zu treff en. Die niedrigeren „Durchimpfungsraten“ in Süddeutschland könnte man daher auch positiv sehen: Hier leben off ensichtlich mehr Menschen, die sich nicht bevormunden lassen. Literatur: Bertilone C, Wallace T, Selvey LA: Finding the ‚who‘ in whooping cough: vaccinated siblings are important pertussis sources in infants 6 months of age and under. Commun Dis Intell Q Rep. 2014, 38(3): E195-200. van der Maas NA, Mooi FR, de Greeff SC et a l.: Pertussis in the Netherlands, is the current vaccination strategy suffi cient to reduce disease burden in young infants? Vaccine 2013, 31(41): 4541-7 Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 45 – impf-report Nr. 109 4. Quartal 2015 Studien lassen mehr Fragen offen, als wir beantworten können von Dr. med. Steff en Rabe Unter der Überschrift „Mehr Schutz als gedacht“ schreibt der Arzt und Journalist Werner Bartens in der Süddeutschen Zeitung vom 27. Feb. 2014 (Bartens 2014) ein Loblied über Schutzimpfungen und beweist einmal mehr, wie wichtig (und off ensichtlich schwierig) es ist, Studien zu diesem komplexen Thema richtig zu lesen… Bartens bezieht sich auf eine dänische Studie aus dem Jahr 2014, in der nach Angaben der Autoren untersucht wurde, ob die MMR-Impfung in Dänemark mit einer geringeren Rate von Krankenhauseinweisungen wegen Infektionskrankheiten im zweiten Lebensjahr assoziiert ist (Sørup 2014). Untersucht und verglichen wurde in der Studie aber vor allem die Auswirkung der Reihenfolge der Schutzimpfungen, und hier fanden die Autoren tatsächlich einen eindrucksvollen Zusammenhang: Bei einer MMR-Impfung nach der (in Dänemark abschlie- ßenden) dritten Fünff achimpfung (D/T/aP/IPV/HIB) war das Risiko einer infektionsbedingten Krankenhauseinweisung im 2. Lebensjahr deutlich geringer als bei einer MMR-Impfung vor der dritten Fünff achimpfung – in letzterem Fall war die Infekthäufi gkeit signi- fi kant erhöht. „Receiving the live MMR vaccine after the inactivated DTaP-IPV-Hib vaccine was associated with a lower rate of hospital admissions for any infection. […] Children who received DTaPIPV-Hib after MMR had a signi- fi cantly higher rate of infectious disease admission.“ Punkt. Eine Schlussfolgerung, wie Bartens sie zieht: „Werden Kinder gegen häufi ge Krankheiten wie Masern, Mumps und Rö teln geimpft, sind sie nicht nur vor diesen Leiden geschützt, sondern sie mü ssen auch generell seltener aufgrund von Infektionen ins Krankenhaus“ fi ndet sich in dieser apodiktisch-allgemeinen Form an keiner Stelle der von ihm zitierten Untersuchung. Beide Aussagen – die der Studie selbst und auch die von Werner Bartens – kranken aber vor allem an einem grundsätzlichen systematisch-methodischen Problem: eine „häufi ger/seltener“-Aussage braucht naturgemäß immer die möglichst genaue Angabe des jeweiligen Vergleichskollektivs und dies müsste, folgte man Bartens verallgemeinernder Aussage, eine Gruppe ungeimpfter Kinder sein. Dann und nur dann könnten Aussagen über den Eff ekt der Impfung an sich gemacht werden. Die dänischen Autoren, unter ihnen der dänische Epidemiologe Peter Aaby, sind sich dieses Problems sehr wohl bewusst und äußern sich im Detail eben nur zum Eff ekt der Impfreihenfolge. Vergleichsuntersuchungen mit ungeimpften Kindern sind in Ländern der westlichen Welt seit Jahrzehnten nicht mehr möglich, es gibt sie aber aus Ländern der sogenannten dritten Welt, und sie und die zur Aufklärung verpfl ichteten Ärzte vor eine unlösbare Aufgabe: Die MMR-Impfstoff e sind in ihrer Sicherheit nur ungenügend untersucht – die Cochrane Collaboration hat dies wiederholt beanstandet (Demicheli 2002, 2012). Damit steht im Grunde die Verfassungsmäßigkeit der Impfempfehlung in Frage. Eine verpfl ichtende Impfung gegen eine in den meisten Fällen harmlos verlaufende Krankheit wie Masern widerspricht dem Recht auf Selbstbestimmung und körperliche Unversehrtheit. Sie ist auch nicht vom Infektionsschutzgesetz gedeckt, das in §20 (6) dafür die „epidemische Verbreitung“ einer Krankheit voraussetzt. Letztlich sind die Masern nicht auszurotten – auch nicht mit Zwangsmaßnahmen, wie das aktuelle Beispiel des Masernausbruchs in Kalifornien zeigt. Reisende, Migranten und Flüchtlinge tragen das Virus um die Welt, und das sekundäre Impfversagen liegt bei fünf Prozent – es kommen also in Deutschland jedes Jahr über 30.000 Menschen trotz zweimaliger Impfung ungeschützt ins Erwachsenenalter, eine immer weiter zunehmende „kritische Masse“. Wir können die Masern nur unter eine gewisse Kontrolle bringen. Die hohe und immer noch steigende Impfbeteiligung von Kleinkindern in Deutschland belegt, dass dafür Aufklärung und freie Impfentscheidung ausreichend sind. Von der behaupteten Impfmüdigkeit keine Spur! Zurück zur Helm- und Gurtpfl icht: Nachdem es immer noch jedes Jahr über 3.000 Verkehrstote gibt, wäre es nach der Logik des Editorials höchste Zeit, den motorisierten Straßenverkehr zu verbieten. Gurtpfl icht, Helmpfl icht, Gehpfl icht. Referenzen: Demicheli, V., Jeff erson, T., Rivetti, A., Price, D.: Vaccines for measles, mumps and rubella in children. The Cochrane Database of Systematic Reviews 2005 Issue 4 Demicheli, V., Rivetti, A., Debalini, M. G., Di Pietrantonj, C.: Vaccines for measles, mumps and rubella in children. Cochrane Database Syst Rev 2012, 15 (2): CD004407 * Worterklärungen Parese Teillähmung (grch. paresis „Erschlaff ung“) Thrombozytopenie Mangel an Thrombozyten (Blutplättchen) im Blut (grch. thrombos „geronnene Masse, Klumpen, dicker Tropfen“ + lat. zytus „Zelle“, von grch. kytos „Höhlung, Urne“ + penia „Mangel“ ) UAW Abkürzung für „unerwünschte Arzneimittelwirkung“ Zerebellitis Entzündung von Kleinhirngewebe (lat. cerebrum „Gehirn“ + -itis „Entzündung“) – 46 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Leserbrief vom 9. Mai 2015 zum Artikel „Masern schwächen die Abwehr langfristig“ in der Süddeutschen Zeitung (SZ) vom 8. Mai 2015. Wissenschaftliche Studien sind so schwer zu lesen und zu verstehen und verführen so sehr dazu, sie zu instrumentalisieren, wenn sie gerade in den publizistischen Mainstream einer masernhysterisierten Medienlandschaft zu passen scheinen… Die dem SZ-Artikel zu Grunde liegende Studie von Mina und Anderen ist eine rückblickende, epidemiologische Untersuchung, in der Daten, die ursprünglich zu völlig anderen Zwecken erhoben wurden (Masernhäufi gkeit, Masern -Impfraten und Sterblichkeit an Infektionskrankheiten), im Nachhinein („retrospektiv“) miteinander verknüpft werden, im Versuch, Zusammenhänge aufzudecken – es ist dies die schwächste Form einer wissenschaftlichen Untersuchung, da solche Studien naturgemäß niemals unterscheiden können zwischen einem ursächlichen und einem zufälligen Zusammenhang; das wissen die Autoren der Studie auch, nur der Über die immunologischen Langzeiteffekte von Infektionskrankheiten ist noch zu wenig bekannt von Dr. med. Steff en Rabe zeigten schon vor Jahren den jetzt in der SZ so euphorisch aufgenommenen Eff ekt: Lebendimpfungen wie die gegen Tuberkulose und Masern senken die Kindersterblichkeit in den ersten Lebensjahren und zwar weit über den durch das Verhindern der Zielerkrankungen zu erwartenden Eff ekt hinaus. Diese Studien zeigten aber eben auch, dass Impfungen gegen Diphtherie, Tetanus, Keuchhusten und Kinderlähmung die Kindersterblichkeit verglichen mit ungeimpften Kindern (!) fast verdoppelten – Autor dieser Studien war schon damals: Peter Aaby (Aaby 2000). Bartens kennt und zitiert diese Arbeiten in seinem Artikel – allerdings nur den ersten, aus der Sicht der Impfungen positiven Teil: „Aus ärmeren Ländern ist schon länger bekannt, dass geimpfte Kinder insgesamt seltener krank werden und auch allgemein besser vor Infektionen geschützt sind“ und gibt spätestens mit dieser einseitigen Darstellung der Studienlage jedweden objektiven Anspruch der Auseinandersetzung mit dem Thema Impfen auf. Eine der wichtigsten Erkenntnisse aus den Untersuchungen, sowohl derer aus dem Jahr 2000, als auch der 2014er, ist jedoch: wieder einmal merken wir, wie wenig wir heute darüber wissen, was Impfungen tatsächlich im menschlichen Körper auslösen. Keiner der beobachteten Eff ekte, weder die „positiven“, noch die „negativen“, war Grundlage der Überlegungen für das Aussprechen einer Impfempfehlung, wurde so erwartet oder ist bis heute befriedigend erklärbar… auf letzteres weist sogar das der Sørup-Studie vorangestellte Editorial hin (auch wenn es von einem kinderärztlichen Kollegen verfasst wurde, der aufgrund seiner zahllosen Interessenkonfl ikte durch Verfl echtungen zu praktisch allen Impfstoff herstellern eigentlich für eine Veröff entlichung in einem seriösen Journal wie dem JAMA völlig disqualifi ziert ist) (Goldblatt 2014). Und die Tatsache, dass sogar Zeitpunkt und Reihenfolge der Impfungen (die auch zwischen westlichen Ländern teilweise deutlich diff erieren) einen solch deutlichen, unerwarteten Einfl uss zum Positiven wie zum Negativen haben, lässt wieder einmal viel mehr Fragen off en, als wir derzeit beantworten könnten. Literatur: Aaby P. BMJ 2000;321:1-8. Bartens W. Sü ddeutsche Zeitung, Mittwoch, den 26. Februar 2014, Seite 14 Goldblatt D. JAMA February 26, 2014 Volume 311, Number 8. 804-05 Sørup S. JAMA. 2014;311(8):826-835. doi:10.1001/jama.2014.470 Dr. med. Steffen Rabe ist Facharzt für Kinderheilkunde und Jugendmedizin und arbeitet seit 15 Jahren in eigener Kinderarztpraxis in München. Neben seinem „klassisch-schulmedizinischem“ Medizinstudium und anschließender langjähriger Ausbildung in einer der größten Kinderkliniken Deutschlands verfügt er über eine Ausbildung in der Klassischen Einzelmittel-Homöopathie nach Hahnemann. Er ist Dozent des Deutschen Zentralvereins homöopathischer Ärzte in der Weiterbildung, hat eine Reihe homöopathischer Fachartikel in renommierten Zeitschriften veröffentlicht und war jahrelang Mitglied der Schriftleitung einer Fachzeitschrift für klassische Homöopathie, dem „Neuen Archiv für Homöopathik“. Im Bereich der Impfthematik ist er Mitbegründer und war jahrelanger Vorsitzender des Vereins „Ärzte für individuelle Impfentscheidung“ e.V. Auch hier hat er zahlreiche Fachartikel veröffentlicht und ist ebenfalls als Dozent in der ärztlichen Weiterbildung im In- und Ausland tätig. Steffen Rabe ist – wie übrigens auch Martin Hirte – Mitverfasser des „Wuppertaler Manifests“, das u. a. mehr Industrieunabhängigkeit bei Zulassung von Impfstoffen, Öffentlichen Empfehlungen von Impfungen und eine sorgfältigere Nutzen-Risiko-Abwägung vor jeder individuellen Impfung fordert. Kontakt: Homöopathisches Ärztehaus, Offenbachstr. 9, D-81245 München, Fon +49 (0)89 8921 7921 Email: info@homoeopathisches-aerztehaus.de Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 47 – impf-report Nr. 109 4. Quartal 2015 ÜbersichtImpfempfehlungeninderEU 1.und2.Lebensjahr Quelle:vaccine-schedule.ecdc.europa.eu LetzterAufruf17.01.2015 © Dr.med.SteffenRabe http://www.impf-info.de Belgien • •• • • • Bulgarien •• • • Dänemark •• • Deutschland • •• • • •• Estland • •• • Finnland •• • • Frankreich •• • • • Griechenland • •• • • •• Großbritannien •• • •• Irland •• • • • Island • • •• Italien •• • • • Kroatien •• • Lettland •• • •• Liechtenstein • • •• Litauen •• • • Luxemburg • •• • • •• Malta •• • Niederlande •• • • • Norwegen •• • • Österreich • •• • • •• Polen • •• • • •• Portugal •• • • Rumänien •• • • Schweden •• • Slowakei •• • • Slowenien • • Spanien • •• Tschechien • •• ••• •• Ungarn •• • Zypern •• • • •• • :allgemeinempfohleneImpfung :keineallgemeinempfohleneImpfung :HervorhebungdurchdenAutor RV T/D/Pert/ Polio/HiB HepB Pneu MenB MenC MMR WiPo – 48 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Autorin des apodiktisch [keinen Widerspruch duldend, d. Red.] formulierten SZ-Artikels scheint dies nicht bewusst zu sein. Mit dieser Art von Studien lie- ße sich z.B. auch spielend ein Zusammenhang untersuchen (und „nachweisen“) zwischen dem in vielen europäischen Ländern zu beobachtenden Rückgang der Zahl brütender Storchenpaare und dem zeitlich parallelen Geburtenrückgang. Nun gibt es zur Frage der immunologischen Auswirkungen der Masernerkrankung einige wissenschaftlich wesentlich aussagekräftigere Studien, die Daten gezielt unter der entsprechenden Fragestellung erhoben haben (diese sogenannten „prospektiven“ Untersuchungen des dänischen renommierten Epidemiologen Aaby werden in der Mina-Studie sogar ausdrücklich erwähnt) und diese zeigten keine langfristig negativen immunologischen Auswirkungen der Masernerkrankung, wohl aber einen bis heute nicht vollständig verstandenen, unspezifi sch schützenden Eff ekt der Masernimpfung vor Todesfällen an anderen Infektionserkrankungen (und das ist überhaupt nicht das Gleiche!). Dass Masern tiefgreifende immunologische Auswirkungen haben, ist unbestritten – das dazu z. B. ein vermindertes Allergierisiko noch mehr als 10 Jahre nach der Erkrankung gehört, haben die Autoren des SZ-Artikels in der von ihnen rezensierten Studie wohl überlesen. Solange wir zu den immunologischen Langzeiteff ekten der Erkrankungen so wenig und zu denen der Impfungen praktisch gar nichts wissen, taugen Untersuchungen wie die besprochene in ihrer Komplexität und der Diff erenziertheit ihrer Ergebnisse kaum für den Versuch, sie als journalistische Schnellfeuermunition im ohnehin viel zu polarisierten Disput über die Schutzimpfungen zu instrumentalisieren. Zum Artikel „Aufregung um Masern“ und zum Kommentar „Keine Panik, sondern Impfen“ von Michael Bragulla in der Landshuter Zeitung vom 31.03.2014 Sehr geehrter Herr Bragulla, für mich als erfahrenen Arzt ist es sehr befremdlich, mit welcher Selbstverständlichkeit Sie sich zum Fürsprecher der Volksgesundheit aufschwingen. Und das mit der beim Thema „Impfen“ üblichen, ober- fl ächlichen Panikmache. Nicht der Verdachtsfall auf Masern „heizt die Diskussion um Impfpfl icht in der Region an“, sondern einzig und allein Ihr einseitiger Artikel mit dem ebenso einseitigen Kommentar dazu. Ich habe als Hausarzt viele Jahre lang Menschen betreut und beraten. Viele meiner Patienten haben sich intensiv mit dem Thema Impfung auseinandergesetzt, sie haben sich ausgiebig Gedanken zum Impfen oder eben zum Nicht-Impfen gemacht – und viele von ihnen haben sich nach reiflicher Überlegung und der Abwä- gung des durchaus vorhanden Für und Wider bewusst gegen Impfungen entschieden. Diese Menschen als „verantwortungslos“ zu beschimpfen zeugt nicht nur von einer unglaublichen Überheblichkeit. Es zeigt auch, dass Sie sich nicht die Mühe gemacht haben, dieses sehr emotionale Thema so zu recherchieren, wie man es von einem Journalisten mit „einem gewissen Bildungsstand“ erwarten könnte. Leider machen sich auch einige Ärzte nicht die Mühe, sich die Widersprüche der gesamten Impftheorie genauer anzusehen und tun wissenschaftlich untermauerte Gegenargumente allzu leicht als Verschwörungstheorie ab. Ich möchte der Diskussion, die nach Ihrem Artikel vermutlich tatsächlich wieder auffl ammen wird, einige sachliche Argumente hinzufügen, möchte sie aber zunächst mit einer Frage zum Nachdenken anregen: Glauben Sie nicht, dass wir bereits seit Langem eine Impfpfl icht hätten, wenn genügend Beweise für eine Wirksamkeit und Unschädlichkeit vorliegen würden? Aber im Gegensatz zur öff entlichen Meinung über Impfungen wissen wir in Wahrheit leider recht wenig darüber. Und die häufi g angeführten epidemiologischen Daten (dass z. B. die Krankheiten nach der Einführung der Impfungen zurückgegangen seien) sind leider aus wissenschaftlicher Sicht nichts wert. Denn derartige Zusammenhänge herzustellen, ist unseriös. Das beste Beispiel zur Verdeutlichung ist der Zusammenhang des gleichzeitigen Rückgangs der Anzahl der Störche und der Geburtenrate. Das beweist schließ- lich auch nicht, dass der Storch die Kinder bringt. Leider gibt es bisher kaum belastbare Studien zur Wirksamkeit von Impfungen und noch weniger Studien zu deren Unbedenklichkeit. Deshalb ist auch die Aussage des Kollegen Ziegler in Ihrem Artikel, dass „das gesundheitliche Risiko durch eine Impfung im Vergleich zu einer Erkrankung zu vernachlässigen“ sei, doch eher leichtfertig. Hier ein paar Fakten dazu, zunächst zur Masern-Impfung, dann auch zu anderen Impfungen, um die Mechanismen darzustellen: Gerade aktuell wurden zwei Studien veröff entlicht, die sich mit der Wirksamkeit der Masern-Mumps-Röteln-Impfung (MMR) auseinandersetzen. So wurde festgestellt, dass bei dem letzten Mumps-Ausbruch in Holland von 2009 bis 2012 2/3 der Erkrankten geimpft waren.1 Im gleichen Zeitraum gab es auch einen Mumps-Ausbruch in den USA, dabei hatten sogar mehr als 80 % der Erkrankten die (angeblich) erforderlichen 2 Impfungen erhalten.2 Befremdliche Selbstverständlichkeit von Dr. med. Harald Hüther Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 49 – impf-report Nr. 109 4. Quartal 2015 Ganz ähnliche, sehr aktuelle Zahlen gibt es von Masern. So zeigte eine groß angelegte Studie in China, dass auch die viel zitierte „Herdenimmunität“ wohl eher Wunschdenken ist, denn trotz Impfraten von über 95 % waren fast die Hälfte (43,3 %) der Erkrankten Geimpfte.3 Bei einem Masernausbruch an einer amerikanischen Schule waren ebenfalls 95 % der Schüler geimpft, trotzdem waren 2/3 der Erkrankten Geimpfte.4 Neben der Frage der Wirksamkeit stellt sich immer auch die Frage nach den Nebenwirkungen. Immer wieder wird beispielsweise die Entstehung von Autismus mit Impfungen in Zusammenhang gebracht. So auch in einer Studie aus dem Jahr 2002, wo bei mehr als 90 % der untersuchten autistischen Kinder spezielle Autoantikörper gegen den MMR-Impfstoff im Gehirn nachgewiesen wurden. Diese Autoantikörper hängen off enbar sehr eng mit der Entstehung von Autismus zusammen.5 Ganz ähnliche Studien gibt es auch von anderen Impfungen, so zum Beispiel von der Grippe-Impfung oder der Hepatitis-B-Impfung. Hier scheint unter anderem der Zusammenhang mit der Entstehung eines Guillain-Barré-Syndromes (meist vorübergehende Querschnittslähmung) so gut wie sicher zu sein. Von 1000 von der amerikanischen Gesundheitsbehörde untersuchten Fällen traten 77 % innerhalb von 6 Wochen nach einer Impfung auf.6 Auch zu anderen Autoimmunerkrankungen wie Lupus erythematodes (SLE)7 und Multipler Sklerose (MS)8 gibt es eindeutige Zusammenhänge. Ein letztes Beispiel betriff t die Grippe-Impfung. Hier wurde gerade eine komplette Neubewertung durch das angesehene Cochrane-Institut veröff entlicht. Das Fazit war, dass eine Grippe-Impfung bei gesunden Erwachsenen (einschließlich Schwangeren) nichts bringt.9 Dazu fi nden sich in einem ähnlichen Übersichtsartikel zur Grippe-Impfung bei Kindern aus dem letzten Jahr noch einige weitere interessante Zusatzinformationen. So fanden die Autoren bei ihrer Recherche keinerlei Daten oder Studien zur Sicherheit von Grippe-Impfstoff en bei Kindern. Außerdem stellten sie fest, dass Impfstudien, die durch die Industrie durchgeführt wurden, deutlich häufi ger in renommierten Journalen veröff entlicht wurden als unabhängig durchgeführte Studien. Diese unabhängigen, meist von öff entlichen Stellen fi nanzierten Studien kamen auch meist nicht zu so berauschenden Ergebnissen.10 Das ist nur eine kleine Übersicht der zahlreichen sehr aktuellen Forschungsergebnisse, die die Diskussion zum Thema „Impfungen“ etwas ausgewogener machen soll. Die entsprechende Literaturliste mit den Links zur (englischen) Originalliteratur kann von allen Interessierten gerne bei mir per E-Mail angefordert werden. Literatur: 1 Sane J. et al.: Epidemic of Mumps among Vaccinated Persons, the Netherlands, 2009-2012. Emerg Infect Dis. 2014 Apr;20(4):643-8. doi: 10.3201/eid2004.131681. 2 Kutty P.K. et al.: Epidemiology and the economic assessment of a mumps outbreak in a highly vaccinated population, Orange County, New York, 2009-2010. Hum Vaccin Immunother. 2014 Mar 14;10(5). [Epub ahead of print] 3 Yang Z. et al.: Measles epidemic from 1951 to 2012 and vaccine eff ectiveness in Guangzhou, southern China. Hum Vaccin Immunother. 2014 Feb 10;10(4). [Epub ahead of print] 4 Yeung L.F. et al.: A limited measles outbreak in a highly vaccinated US boarding school. Pediatrics. 2005 Dec;116(6):1287-91. 5 Singh V.K. et al.: Abnormal measles-mumps-rubella antibodies and CNS autoimmunity in children with autism. J Biomed Sci. 2002 Jul-Aug;9(4):359-64. 6 Souayah N. et al.: Guillain-Barré syndrome after vaccination in United States: data from the Centers for Disease Control and Prevention/Food and Drug Administration Vaccine Adverse Event Reporting System (1990- 2005). J Clin Neuromuscul Dis. 2009 Sep;11(1):1-6. doi: 10.1097/ Dr. med Harald Hüther, geboren 1967 in München, studierte nach erfolgreichem Abitur Humanmedizin an der Ludwig-Maximilian-Universität München. Neben dem Studium war er beim Bayerischen Roten Kreuz des Kreisverbandes Landshut tätig. Die Famulaturen absolvierte Dr. Hüther in den Abteilungen Orthopädie, Anästhesie, Pädiatrie, Allgemeinmedizin und in der Inneren Medizin. Seinen Schwerpunkt im Modellstudiengang Naturheilverfahren beim „Münchner Modell“ zur Integration von Naturheilverfahren in Forschung und Lehre, fokussierte er auf die Manuelle Therapie, Phytotherapie und Homöopathie. Die praktischen Jahre seiner medizinischen Ausbildung verbrachte Dr. Harald Hüther an der Kinderpoliklinik München in der Abteilung Onkologie und am Klinikum Landshut im Bereich Innere Medizin und Chirurgie. Nach einjähriger Tätigkeit in der Praxis von Dr. R. Machens in Landshut, wechselte er an das Kreiskrankenhaus Achdorf/Landshut, um in der Inneren Medizin mitzuwirken. Als Assistenzarzt im Kreiskrankenhaus in Simbach am Inn widmete sich Dr. Hüther den Naturheilverfahren. 1997 gründete er schließlich eine eigene Praxis in Kumhausen bei Landshut. Bis 2008 war Dr. Harald Hüther in seiner eigenen Praxis unter anderem im Bereich Neuraltherapie tätig. Seit 2008 ist er medizinischer Leiter des Institutes für Vorsorge und moderne Vitalstoffmedizin. Zudem gehören umfangreiche, deutschlandweite Vortragstätigkeiten zu seinem Aufgabengebiet. Kontakt: Institut für Vorsorge und moderne Vitalstoffmedizin (VmV), Am Holzacker 13, 84184 Tiefenbach, info@institut-vmv.de – 50 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 CND.0b013e3181aaa968. 7 Geier D.A., Geier M.R.: A case-control study of serious autoimmune adverse events following hepatitis B immunization. Autoimmunity 38(2005): 295-301 8 Orbach H. et al.: Vaccines and autoimmune diseases of the adult. Discov Med. 2010 Feb;9(45):90-7. 9 Demicheli V. et al.: Vaccines for preventing infl uenza in healthy adults. Cochrane Database Syst Rev. 2014 Mar 13;3:CD001269. [Epub ahead of print] 10 Jeff erson T. et al.: Vaccines for preventing infl uenza in healthy children. Cochrane Database Syst Rev. 2012 Aug 15;8:CD004879. doi: 10.1002/14651858.CD004879. pub4 Die Geschichte der HPV-Impfung gegen Gebärmutterhalskrebs, die bisher weiß Gott wenige Höhepunkte aufzuweisen hat, erreichte im Juni 2013 einen neuen Tiefpunkt: Das japanische Gesundheitsministerium hat de fakto bestätigt, man habe kein Vertrauen mehr in Gardasil und Cervarix. Auch wenn die Impfstoff e im Land weiterhin frei verfügbar sind, sind japanische medizinische Stellen laut Gesetz verpfl ichtet, vor dem Einsatz der Impfstoff e junge Mädchen und ihre Eltern darüber zu informieren, dass die Regierung diese Impfstoff e nicht weiter empfi ehlt, da sie eine Reihe von Nebenwirkungen mit sich bringen. Die amerikanische Food and Drug Administration (FDA) hat zwei HPV-Impfstoff e zugelassen: GARDASIL der Firma Merck und Co, und das CERVARIX der Firma GlaxoSmithKline. Beide Impfstoff e spülten allein 2012 mehr als 2 Milliarden US-Dollar in die Kassen der Pharmakonzerne. Im Februar 2013 verklagte die Verbraucherorganisation Judical Watch das US-Gesundheitsministerium im Rahmen des Freedom of Information Act (FOIA) auf die Herausgabe von Dokumenten zum Thema HPV-Impfung und des regierungseigenen Impfschadenkompensationsprogramms (National Vaccine Injury Compensation Program, VICP). Als die angeforderten Informationen schließlich vorlagen, stellte sich heraus, dass die amerikanische Regierung bei der Regulierung von 200 Fällen an 49 Opfer der HPV-Impfung nahezu 6 Millionen Dollar Schadensersatz gezahlt hatte, wobei erst die Hälfte der Schadenfälle verhandelt worden sind. Wie ich schon früher angemerkt habe, erinnert die Lektüre eines Dokuments über Nebenwirkungen einer HPV-Impfung der Lektüre eines Buches mit dem Titel: „Der Alptraum eines jeden Elternpaares“. Zu den bisher bekannten Nebenwirkungen der HPV-Impfung zählt ein bunter Strauß von unerwünschten Reaktionen wie z. B. das Guillain-Barre Syndrom, Krampfanfälle, schwere Schmerzzustände Erschöpfungssyndrome, Zittern, Unfruchtbarkeit, spontane Fehlgeburten und sogar Tod. Bis Juli 2013 sind mindestens 47 Frauen und Mädchen nach der HPV-Impfung verstorben. Die Injektion ist zudem mit Gebärmutterhalskrebs im Vollbild und Entstehen eben jener Genitalwarzen in Zusammenhang gebracht worden, vor deren Auftreten sie eigentlich schützen soll. Tatsächlich erreicht die Zahl der bisher gemeldeten Nebenwirkungen einer HPV-Impfung – bis heute nahezu 10.000 Fälle – fast die Anzahl von 12.200 Frauen, die laut amerikanischem National Cancer Institute (NCI) jährlich in den USA an Gebärmutterhalskrebs erkranken. Eine Bewertung dieser Impfstoff e hat gezeigt, dass in Studien, die während der Zulassungsphase von Cervarix und Gardasil abgeschlossen wurden, signifi kante Daten fehlten, mit denen die Wirksamkeit der Impfstoff e belegt werden kann, da die Untersuchungen einfach zu kurz waren. Eine Analyse der Zeitschrift Annals of Medicine aus dem Jahre 2011 kam zu dem Ergebnis: “Die Wirksamkeit der HPVImpfstoff e bei der Verhütung von Gebärmutterhalskrebs ist nie belegt worden, während die Impfstoff risiken [immer] noch nicht vollständig bestimmt worden sind.“ Was aber noch schwerer wiegt: Es sind Berichte aufgetaucht, nach denen Frau Dr. Diane Harper, eine der leitenden Merck-Forscherinnen, bei der Entwicklung der Impfstoff e auf einer öff entlichen Konferenz 2009 zugegeben hat, dass der Impfstoff grundsätzlich sinnlos ist. Steven Mosher von Moshers Population Research Institute: „Tatsächlich überraschte [Frau Dr. Diane Harper, eine leitende Forscherin aus Mercks Entwicklungsabteilung] ihre Zuhörer mit der Anmerkung, die Inzidenz des Gebärmutterhalskrebses in den USA sei so gering, dass ‚… wir dieWarum hat Japan 2013 die HPV-Impfung gestoppt? Im Juni 2013 wurde die Empfehlung der HPV-Impfung von der japanischen Regierung überraschend zurückgezogen, nachdem bei 38 zuvor geimpften Mädchen starke Schmerzen und Taubheitsgefühle eintraten. Je tiefer man in das Thema einsteigt, desto mehr stellt sich die Frage, wie die HPV-Impfstoffe überhaupt zugelassen werden konnten. von Melissa Melton, truthstreammedia.com Übersetzung: Axel Berendes Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 51 – impf-report Nr. 109 4. Quartal 2015 se Inzidenz auch dann nicht weiter senken können, wenn wir die Impfung einsetzen und das PAPScreening fortsetzen.‘ “ Später sagt Frau Dr. Harper aus, sie habe diese Äußerungen getan, um „nachts besser schlafen zu können“. Regierungskorruption wie aus dem Lehrbuch Frau Dr. Julie Gerberding, in den Jahren 2002 bis 2009 Leiterin des amerikanischen Centers for Disease Control and Prevention (CDC), half Merck 2004 mit einem Bericht an den US-Kongress direkt dabei, den Weg für GARDASIL zu ebnen. Nachdem sie 2009 das CDC verlassen hatte, kehrte Frau Dr. Gerberding direkt durch die Drehtür zwischen Regierung und Megakonzernen zurück, um einen Job als Leiterin von Mercks Impfstoff abteilung anzutreten. Sehen Sie nun, wie der Hase läuft? Eine interessante Information am Rande: Wie eine Global Burden and Disease-Untersuchung vom Stand 2013 zeigte, haben die Japaner aus einer Gruppe von 187 Ländern weltweit die höchste Lebenserwartung. Obwohl die USA jährlich mehr als 2,7 Billionen Dollar für ihr Gesundheitswesen ausgeben, standen sie hinsichtlich ihrer Lebenserwartung bei den Männern auf Platz 29 und bei Frauen sogar auf dem 33. Platz. Das beantwortet auch die Frage, warum die japanische Regierung auf Basis der Erkenntnisse eine vernünftige Entscheidung triff t und die Verabreichung eines off ensichtlich gefährlichen Impfstoff s verbietet, während die FDA die US-Bürger nach wie vor beschwichtigt, es bestehe kein Grund zur Sorge, man solle sich nur weiter impfen lassen, die Impfung sei „sicher und wirksam“. Quelle: Melissa Melton, Japan Stops HPV Vaccines Citing Adverse Eff ects, TruthStreamMedia, 14 Jul 2013 11:18 AM PDT Autismus, ADHD/ADHS & Asthma: Welche Rolle spielt Paracetamol? Trotz jahrzehntelanger Forschung kennt die offi zielle Medizin die Ursachen von Autismus, ADHD/ADHS oder Asthma immer noch nicht. Obwohl sich seit Jahren eine epidemieartige Zunahme der Fallzahlen zeigt, deren Ende noch gar nicht absehbar ist, genießen diese modernen Epidemien bei den zuständigen Behörden und Ministerien nicht die Priorität, die sie verdienen. Könnte dies vielleicht mit der möglichen verursachenden Rolle von Medikamenten, z. B. von Paracetamol, zusammenhängen? von Sophie Middleton, ANH International vom 12. Dez. 2013 Übersetzung: Axel Berendes Wie man annimmt, entwickelt mindestens eines von 90 Kindern eine autistische Störung, manche Schätzungen gehen sogar von einem von 50 Kindern aus. 1,2 Was noch beunruhigender ist: Die Häufi gkeit autistischer Störungen nimmt weiter stark zu und das Risiko ist bei Jungen etwa viermal so hoch wie bei Mädchen.3 Könnte ein Zusammenhang mit der Anwendung von Paracetamol bestehen? Noch kein endgültiges Urteil Noch existiert über die eindeutigen Ursachen autistischer Störungen kein einhelliges Urteil. Es besteht als Folge von Untersuchungen an eineiigen Zwillingen ein Konsens, dass eine grundlegende genetische Empfänglichkeit manche Kinder für Autismus prädisponieren kann. Besteht eine derartige Vorbelastung, können Belastungen durch bestimmte Umweltreize als Auslöser wirken, egal ob diese als Pathogene, Chemikalien oder andere Stressoren daherkommen. Sogar die Europäische Kommission erkennt an, dass ein dysfunktionelles Immunsystem hier eine Rolle spielen kann.4 Gluten aus Getreide könnte ein weiterer Faktor sein.5 Heute gilt es immer mehr als erwiesen, dass Andrew Wakefi elds zentrales Forschungsgebiet – eine Störung des Darms bzw. Dysbiose – eng mit dem Autismus zusammenhängt.6,7 Es ist Realität, dass eine ASD ein Komplex aus unterschiedlichen Symptomen darstellt und es überrascht nicht, dass auch die Auslöser ähnlich komplex sein können. Dennoch ist die Tatsache Die wichtigsten Fakten – Störungen des autistischen Formenkreises (Autism Spectrum Disorders, ASD) betreffen bis zu 1 unter 50 Kindern. – Die Ursachen von Autismus sind noch nicht nachgewiesen. – Es wächst die Zahl der Hinweise, dass ein Komplex aus prädisponierenden und auslösenden Faktoren wie z. B. Umwelteinfl üsse, Ernährungs- und Immunstatus die Entwicklung einer Störung des autistischen Spektrums (ASD) beeinfl ussen könnte. – Der langjährige Autismusexperte Dr. William Shaw legt dar, warum Paracetamol, das nach einer Impfung verabreicht wird, einen Risikofaktor darstellen könnte. – 52 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 verwunderlich, dass der Autismus weltweit nicht sehr weit oben auf der Agenda der Gesundheitsexperten steht, wenn man das Ausmaß des menschlichen Leidens und die sozialen und ökonomischen Probleme betrachtet, die diese Erkrankung in den kommenden Jahrzehnten auslösen wird. Man kann nur annehmen, dass das etwas mit der fehlenden Zauberkugel in Form eines pharmazeutischen Mittels gegen den Autismus zu tun haben dürfte. Ritalin, das häufi g bei Autismus verordnet wird, scheint mehr zu schaden als zu nutzen.8 Zusammenhänge zwischen Paracetamol und Autismus Wie sieht es nun mit Paracetamol aus, jener Substanz, die sich in zahlreichen Schmerztabletten fi ndet? Dr. William Shaw ist der Gründer der amerikanischen Great Plains Laboratory, dem Labor, das eine große Anzahl von Tests anbietet, mit deren Hilfe Kliniker angemessene integrative Strategien zur Behandlung ihrer Patienten entwickeln können. Vor der Gründung der Great Plains Laboratory arbeitete Dr. Shaw für das Centers for Disease Control and Prevention (CDC), das Children’s Mercy Hospital, die medizinische Hochschule Kansas City und die Smith Kline Laboratorien.9,10 Er ist Autor der Bücher „Biological Treatments for Autism and PDD“ aus dem Jahre 1988 und „Autism: Beyond the Basics“, aus dem Jahr 2009.11,12 Dr. Shaw hat einen Artikel im neu gegründeten, durch Experten begutachteten („peer-reviewed“) Journal of Restorative Medicine veröff entlicht. In diesem Artikel führt er Gründe auf, warum Paracetamol nach einer MMR-Impfung eine Rolle bei der Entwicklung von Autismus spielen könnte.14 Die Gabe von Paracetamol nach einer Impfung ist ein gewöhnliches Verfahren von Ärzten und Eltern, die damit die mit Fieber einhergehenden Nebenwirkungen des Impfstoff s lindern möchten. Geringe Autismushäufi gkeit in Kuba Shaw beschäftigt sich mit einem höchst interessanten Aspekt des zweifelsohne multifaktoriellen und komplexen Themas Autismus und anderen „modernen“ Seuchen wie z. B. Asthma und ADHS: Die (Neben-)Wirkungen von Medikamenten, die üblicherweise nach der Impfung von Kindern verabreicht werden. Dabei weist er auf eine interessante Anomalität hin. In Kuba ist die Autismushäufi gkeit unglaublich gering (0,00168 %, in den USA sind es 0,5 % der Bevölkerung).15 Obwohl die Impfquote in Kuba bis zu 95 % beträgt, ist Paracetamol dort nur auf ärztliche Verordnung erhältlich und wird daher nicht routinemäßig verwendet, um Fieberschübe nach einer Impfung zu verhüten oder zu behandeln. Auff allende Parallelen Die massive Zunahme von Autismus und Asthma fällt mit dem Ersatz von Aspirin durch das Paracetamol in den 1980ern zuAnstieg von Autismus (rot) und Asthma (grün) in den USA und markante Warnungen über Nebenwirkungen von Paracetamol in den Jahren 1977, 1980, 1982 und 1986. Von Shaw überarbeitete Version von Becker KG, Schultz ST. Med Hypotheses 2010;74:7–11 Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 53 – impf-report Nr. 109 4. Quartal 2015 sammen. Die Zeitlinie der Medikamentengeschichte mit dem Rückgang seines Einsatzes als Folge von Beunruhigungen der Bevölkerung zeigt auff ällige Parallelen zur Häufung dieser Erkrankungen. Gestörte Entgiftung über die Leber Shaw bietet eine plausible Erklärung dafür, wie das Paracetamol bei genetisch und metabolisch vorbelasteten Kindern das Auftreten von Autismus begünstigen könnte. Wie sich gezeigt, hat leiden diese Kinder alle unter einem Mangel des Leberenzyms Phenol-Sulfotransferase, das unverichtbar für die Entgiftung von Paracetamol und anderen Verbindungen in der Leber ist.17 Mit der Störung dieses Sulfi erungsprozesses in der Leber führt eine Paracetamol-Dosis zu einer Überproduktion des toxischen Metaboliten N-Acetyl-p-Benzoquinon Imin (NAPQI). Der erhöhte oxidative Stress im Körper führt zu Schäden an Proteinen, Lipiden und Kernsäuren durch die freien Radikale. Ein hoher Paracetamol-Verbrauch erschöpft auch die Reserven des Glutathion, eines wichtigen Leberenzyms.18 Genau das Gleiche gilt für das Quecksilber, das in einigen Impfstoff en enthalten ist – allerdings nicht in der MMR-Impfung. Das führt zum Tod von Gehirnzellen und weiteren metabolischen und immunologischen Konsequenzen – ein Muster, das man beim Autismus regelmäßig antriff t. Paracetamol nach der MMR-Impfung: Der letzte Strohhalm? Weiß man um den Enthusiasmus, mit dem sie von Ärzten, der Pharmaindustrie und Gesundheitsbehörden bedrängt werden, ist es nur verständlich, dass die meisten Eltern und Erziehungsberechtigten den populären Paracetamolpräparaten, die häufi g zur Bekämpfung von Schmerzen und Fieber – auch nach einer Impfung – eingesetzt werden, sehr viel Vertrauen schenken. In seinem Artkel liefert Shaw eine Aufzählung der gefährlichsten Nebenwirkungen des Paracetamol mit entsprechenden Literaturverweisen. Den meisten Eltern steht diese Art von ernüchternden Informationen nicht zur Verfügung.20 Eine Online-Befragung durch Wissenschaftler der Universität von Kalifornien in San Diego, die 2008 in der renommierten Zeitschrift Autism veröff entlicht wurde, kommt ebenfalls zu der Vermutung, dass die Gabe von Paracetamol-Präparaten nach einer MMR-Impfung mit der Entwicklung von Autismus in Verbindung gebracht werden kann.21 Mehr Grund zur Sorge Nimmt man sie für bare Münze, verschaff t diese Information – auch wenn sie zugegebenermaßen mechanistische Indizien und keine Kausalzusammenhänge liefert – den Eltern eine bessere Position bei der Beurteilung, was für ihre Kinder das Beste ist. Und es sieht ganz so aus, als ob die freizügige Verabreichung von Paracetamol nach einer MMR-Impfung ein Angriff auf die Gesundheit vieler dieser Kinder sein dürfte, die anfällig für Autimus sind. Quelle: Sophie Middleton, „Could paracetamol (acetaminophen) be linked to autism, ADHD and asthma in children?“ Alliance for Natural Health (ANH), 12. Dez. 2013 Schädliche Auswirkungen von Paracetamol – Neurotoxische Effekte auf Neuronen in Rattenhirnen – Die Einnahme während der Schwangerschaft wird mit krankhaften Veränderungen im Magen-Darm-Trakt in Verbindung gebracht – Paracetamol bildet bzw. induziert äußerst giftige Stoffwechselprodukte wie N-Acetyl-p-Benzoquinon Imin (NAPQI) oder Peroxynitrit, die oxidative Schäden an Proteinen, Lipiden, Kernsäuren und Aminosäuren anrichten und so vermehrt zu mitochondriellen und zellulären Schäden bzw. Tod führen können – Schwere Immunanomalitäten schon bei Dosierungen, die nicht leberschädigend wirken wie z. B. Unterdrü- ckung der Produktion bestimmter Antikörper und Reduktion spezielle B-Zellen – Unterdrückt bei Mensch und Tieren die Immunantwort auf Impfungen – Erschöpfung der Glutathionreserven durch Paracetamol führt zu schwerer Übersäuerung – Häufi gste Ursache für Leberversagen in den USA – Häufi gste Ursache von Nebenwirkungen, die eine notfallmäßige Behandlung erfordern (in den USA jährlich 56.000 Fälle) – Zusammenhänge mit einem erhöhten Auftreten von bestimmten Blutkrebsarten – Wird bei prä- oder postnatalem Einsatz mit einer erhöhten Asthmahäufi gkeit in Verbindung gebracht Quelle: William Shaw, Ph.D., Evidence that Increased Acetaminophen use in Genetically Vulnerable Children Appears to be a Major Cause of the Epidemics of Autism, Attention Defi cit with Hyperactivity, and Asthma, Journal of Restorative Medicine 2013; 2: – 54 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Das Ganze sieht auf den ersten Blick auch sehr logisch und nachvollziehbar aus. Doch der Teufel steckt natürlich auch hier im Detail. Ein Beispiel: Es werden in der Leitlinie fünf verschiedene „ursachenspezifi sche Defi nitionen“ unterschieden: 1. Durch „dem Impfstoff inhärente Eigenschaften“ bedingte Reaktionen. 2. Durch Qualitätsmängel bedingte Reaktionen. 3. Unsachgemäße Handhabung. 4. Emotionale Reaktionen, „z. B. durch Impfangst bedingt“. 5. Zufall. zu 1) „Was der Impfexperte nicht kennt, existiert für ihn auch nicht“ Wer bestimmt, was eine dem Impfstoff innewohnende, anhaftende Eigenschaft ist? Was ist mit bestimmten toxischen Wirkungen, die inzwischen in manchen Fachkreisen intensiv diskutiert, aber bisher weder von Behörden und Herstellern anerkannt werden? Und was ist mit direkten und indirekten Wirkungen, die noch gar nicht verstanden werden? zu 2) „Opfere eine Charge und Du rettest den Impfstoff “ Die übliche Praxis bei gehäuft auftretenden Impfkomplikationen ist der Versuch, dies auf Qualitätsmängel bei bestimmten Produktionschargen zu schieben. Damit bleibt der Impfstoff als solcher unangetastet und der Hersteller bekommt die Gelegenheit, bestimmte Chargen zurückzurufen und sich dabei auch noch als „besonders vorsichtig“ hervorzutun. zu 3) „Opfere den einzelnen Impfarzt und Du rettest den Impfstoff “ Eine unsachgemäße Handhabung kann tatsächlich vorkommen. Manchmal versuchen Behörden und Hersteller aber auch nur, das Problem auf den einzelnen Arzt abzuschieben, damit der Impfstoff unbeschadet bleibt. Und: Selbst Impfkomplikation im Zusammenhang mit einer unsachgemäßen Handhabung bedeuten nicht automatisch, dass diese Impfkomplikation bei „sachgemäßer“ Handhabung NICHT aufgetreten wäre. zu 4) „Das muss eine Einbildung sein“ Als ich den Punkt „emotionale Reaktionen, z. B. durch Impfangst bedingt“ las, dachte ich zunächst an die Möglichkeit, dass damit bei der geimpften Person durch starke Ängste hervorgerufene psychosomatische Symptome gemeint sind, die ohne diese Ängste nicht aufgetreten wären – was natürlich in Einzelfällen möglich ist. Doch die Formulierung ist so vage und off en gehalten, dass sie auch noch eine andere Möglichkeit einschließt: Da kann es Ihnen als Mutter z. B. passieren, dass Sie den Impfarzt auf deutliche Verhaltensänderungen Ihres Säuglings hinweisen und der Arzt Ihnen daraufhin das sogenannte „Münchhausen-Syndrom“ bescheinigt. Damit unterstellt er Ihnen, dass Sie die Impfkomplikation Ihres Kindes erfunden haben, um Aufmerksamkeit auf sich ziehen. In „sehr hartnäckigen“ Fällen kann dies sogar die Einweisung in eine psychiatrische Anstalt und die Kindeswegnahme nach sich ziehen. Diese Diagnosestellung, die vor einigen Jahren in England aufkam, kann für Impfärzte unter Umständen eine willkommene Methode sein, sich „schwierige“ Eltern vom Leib zu halten. Als Folge der neuen WHO-Leitlinien vermute ich auch in Deutschland einen starken Anstieg dieser Willkür-Diagnose. zu 5) „Zufall – der letzte Rettungsanker, wenn alles andere nicht hilft“ Wenn alles andere nicht hilft, dann erklärt das PEI eine Impff olge auch gerne mal als reinen Zufall, mit der Begründung, diese Art von Erkrankungen würden bei Geimpften nicht häufi ger auftreten als beim Bevölkerungsdurchschnitt. Doch obwohl beim PEI kluge Menschen mit Doktoren- oder gar Professorentiteln beschäftigt sind, wird dabei außer Acht gelassen, dass die Mehrheit der Bevölkerung geimpft ist und man eigentlich Geimpfte und Ungeimpfte miteinander vergleichen müsste, um zu sehen, ob es einen möglichen Zusammenhang gibt. Anleitung für einen Freibrief Wie also sind die neuen WHO-Richtlinien zu bewerten? Wenn wir berücksichtigen, dass die WHO-Spitze nachgewiesenerma- ßen sehr eng mit den Lobbyisten der Impfstoff hersteller kooperiert, dann können wir davon ausgehen, dass diese Richtlinien von den Herstellern direkt oder indirekt abgesegnet wurden. Tatsächlich lesen sich diese fünf „ursachenspezifi schen Defi nitionen“ wie eine Anleitung, wie man einem betroffenen Impfstoff am besten einen Freibrief ausstellt. Das eigentliche Problem, nämlich eine fatale Beweislastumkehr durch die zuständigen Behörden, wird durch die neuen Leitlinien nicht nur nicht gelöst, sondern sogar noch verstärkt. Um das zu Neuer WHO-Leitfaden für die Bewertung von Impfkomplikationen Die WHO hat einen neuen Leitfaden für die Bewertung von Impfkomplikations-Verdachtsfällen herausgegeben. Unkritisch und folgsam, wie unsere deutsche Zulassungsbehörde für Impfstoffe, das Paul-Ehrlich-Institut (PEI), nun mal ist, hat sie diese Kriterien 1:1 übernommen von Hans U. P. Tolzin Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 55 – impf-report Nr. 109 4. Quartal 2015 verstehen, müssen wir bedenken, dass jede Impfung rechtlich gesehen eine Körperverletzung eines gesunden (!) Menschen darstellt, zu dem der Impfl ing bzw. seine Eltern die mündige Einwilligung geben müssen. Diese mündige Einwilligung kann aber nur dann gegeben werden, wenn Hersteller und Behörden nachweisen können, dass ein Impfstoff sicher ist. Die Beweislast liegt somit beim Hersteller und den Behörden und NICHT beim Betroff enen. Eine Unsicherheit bezüglich eines möglichen Zusammenhangs, z. B. bei unzureichender Datengrundlage, muss also zu einem „im Zweifel gegen den Impfstoff “ führen statt zu einem „im Zweifel für den Impfstoff „, wie es seit Jahrzehnten Praxis ist – und aus meiner Sicht durch die neuen Leitlinien manifestiert wird. Entscheidend ist allein der zeitliche Zusammenhang mit der Impfung und das Fehlen von plausiblen Alternativen für die Ursachenklärung. Auch wenn die zeitlichen Abstände zu den Impfungen Wochen oder gar Monate betragen, so ist der Zusammenhang ernsthaft zu erwägen. Nur dadurch kann dafür gesorgt werden, dass Behörden und Hersteller endlich für ordentliche Studien sorgen, in denen Geimpfte und Ungeimpfte ergebnisoff en miteinander verglichen werden, die auch groß genug sind und lang genug laufen, um eine belastbare Aussage über bestimmte gehäufte Erkrankungen von Geimpften machen zu können. Literatur: Bulletin für Arzneimittelsicherheit, März 2014, S. 31ff Die Giftigkeit von Aluminiumverbindungen wird vom PEI nicht grundsätzlich bestritten: „Neurotoxische Wirkungen wie Eff ekte auf Knochenentwicklung und die Fortpfl anzung sind bekannt.“ Ebenso weiß man von möglichen schädlichen Wirkungen auf das Gehirn. Als Argument dafür, dass die Verwendung in Therapieallergenen unbedenklich sei, werden vor allem folgende Argumente angeführt: 1. Es liegen nur sehr wenige Daten über die Risiken von Aluminium vor. 2. In den verwendeten geringen Dosierungen sei Aluminium unbedenklich. 3. Aluminiumsalze seien schwer löslich und seien deshalb nur über einen größeren Zeitraum bioverfügbar. Zu 1) ist festzuhalten, dass fehlende Daten über die Risiken der Verwendung von als stark neurotoxisch bekannten Substanzen eigentlich eindeutig gegen die Verwendung der entsprechenden Medikamente sprechen, zumindest so lange, bis ausreichend Daten vorliegen. Das PEI handelt hier aus meiner Sicht grob – wenn nicht gar vorsätzlich – fahrlässig. Für 2) gilt ähnliches. Ob die Verwendung von Aluminiumverbindungen in bestimmten Dosierungen unbedenklich ist, kann nur durch entsprechende Studien, am besten durch mindestens ein Jahr lang laufende doppelblinde Placebostudien, bestimmt werden. Solche Sicherheitsstudien, insbesondere bei Injektion dieser Substanzen unter die Haut oder in den Muskel, werden von Seiten des PEI nicht von den Herstellern verlangt. Somit ist das PEI selbst eine der Hauptursachen für das Fehlen von Sicherheitsdaten… Der Punkt 3) spricht aus meiner Sicht für ein erhöhtes Risiko mittel- und langfristig entstehender chronischer Erkrankungen, die schließlich kaum noch der Ursache zugeordnet werden können. Auch hier fehlt dem PEI off enbar die notwendige Ein- und Weitsicht. Stellungnahme von Christoph Plothe, Heilpraktiker Christof Plothe, Heilpraktiker und Spezialist für chronische Vergiftungen, schreibt mir als Reaktion auf diese PEI-Meldung, dass es seiner Ansicht nach bei Aluminium keine ausreichende Grenzwertbestimmung insbesondere bei Kindern gibt. Des Weiteren werde der synergetische Eff ekt völlig ausgeklammert. Dies bedeutet, dass die giftige Wirkung von Aluminium sich durch andere giftige Substanzen vervielfachen kann. Ebenso unterschlagen werde PEI: „Kein Risiko durch Injektionen von Aluminiumverbindungen“ Das Paul-Ehrlich-Institut (PEI) hat als die zuständige Zulassungsbehörde am 21. Januar 2014 auf seiner Webseite eine Stellungnahme zur Verwendung von Aluminiumhydroxid in sogenannten Therapieallergenen veröffentlicht. Therapieallergene werden zur Desensibilisierung bei Allergien injiziert. Sie enthalten im Wesentlichen allergene Substanzen in Kombination mit sogenannten Adjuvanzien, in der Regel Aluminiumhydroxid. Dies ist eine, wie wir heute wissen, extrem giftige und gesundheitsschädliche Substanz – welche auch in den meisten aktuellen Impfstoffen enthalten ist! von Hans U. P. Tolzin, mit Stellungnahmen von HP Christoph Plothe und dem Arzt Peter Jennrich – 56 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 die mögliche negative Wirkung von bedenklichen Partikeln in Nanogröße im menschlichen Organismus. Er fordert ebenfalls Unbedenklichkeitsstudien, z. B. für den Einsatz in Impfstoff en. Plothe beruft sich auf namhafte Forscher, die sich mit den Risiken von Aluminium im menschlichen Organismus intensiv auseinandergesetzt haben, wie z. B. Dr. C. Exley, Dr. R. Gheradi, Dr. Joachim Mutter, Dr. C. Shaw, Prof. V. Stenjskal, Prof. Y. Shoenfeld oder Dr. L. Tomljenovic. Anerkannt sei eine durch Aluminium in Impfungen induzierte Erkrankung namens „Makrophagische Myofasciitis“, die eine Lähmung von Gliedmaßen auslöst und mit Autoimmunerkrankungen einhergehen kann. Wissenschaftliche Quellen dazu fi ndet man in der medizinischen Datenbank PubMed unter dem Suchwort „Macrophagic Myofasciitis“, z. B. folgende Arbeit von Exley C. et al.: A role for the body burden of aluminium in vaccine-associated macrophagic myofasciitis and chronic fatigue syndrome, PMID 19004564. Plothe: „Impfi nduzierte Myofasciitis und das chronische Erschöpfungssyndrom haben gemeinsame Leitsymptome und zeichnen sich durch abweichende immune Antworten unklarer Genese aus. Exley et al. beschreibt einen Patienten, der nach einer aluminiumhaltigen Impfung CFS* entwickelte. Eine Muskelbiopsie bestätigte die Präsenz von MMF*: Lokalen entzündlichen Infi ltrationen von Makrophagen mit hauptsächlich CD 8 Lymphozyten. Die Al Konzentration war nach der Impfung im Urin ebenso erhöht.“ Stellungnahme Peter Jennrich, Arzt für Allgemeinmedizin und Naturheilverfahren Eine weitere Stellungnahme liegt mir von Peter Jennrich, Facharzt für Allgemeinmedizin und Naturheilverfahren, vor: „In der aktuellen Stellungnahme zur Sicherheitsbewertung von Aluminium in Therapieallergenen geht das Paul-Ehrlich-Institut (PEI) zu wenig diff erenziert an die Fragestellung heran, ob Kinder oder Erwachsene durch eine subkutane Immuntherapie (SKI) mit aluminiumhaltigen Adjuvanzien langfristig gefährdet werden. Dies gilt insbesondere für die Gruppe von genetisch suszeptiblen [empfänglichen, Anm. d. Red.] Patienten und für Patienten, die bereits eine Vorbelastung mit Aluminium und anderen potentiell toxischen Metallen haben. Dem Prinzip der Vorsorge folgend, wie es von der ‚Kommission der Europäischen Gemeinschaften‘ im Jahr 2001 defi niert wurde, sollte analog der Einsatz von Aluminium in Therapieallergenen neu bewertet werden, mit dem Ziel Aluminiumhydroxid als Adjuvans aus den Therapieallergenen zu entfernen. Begründung: Die Toxizität von Aluminium wird durch die Erhöhung des zellulären Glutathion-Spiegels deutlich abgeschwächt. Entsprechend werden bei Aluminiumbelastung die Glutathion Transferasen hochreguliert, um den Organismus zu schützen. Gleiches scheint für die Cytochrom P 450 Monooxidasen zuzutreff en: auch hier gibt es Hinweise, dass die Hochregulierung der CYP 450 Aktivität eine Schutzreaktion als Folge einer Aluminiumbelastung ist. Dementsprechend ist mit hinreichender Wahrscheinlichkeit davon auszugehen, dass bei Deletion eines oder mehrerer Gene der Glutathion S-Transferasen (GSTM 1, GSTT 1) eine erhöhte Empfi ndlichkeit gegenüber den toxischen Wirkungen von Aluminiumhydroxid besteht. Dabei muss man berücksichtigen, dass bei etwa 50 % der kaukasischen Bevölkerung eine homozygote Deletion des Gens GST-M1 vorliegt und bei etwa 38% eine homozygote Deletion des Gens GST-T1. Die betroff enen Bevölkerungsgruppen exprimieren die entsprechenden Enzyme nicht. Auch bei einer verringerten CYP 450-Aktivität ist von der Möglichkeit einer erhöhten Empfi ndlichkeit gegenüber den toxischen Wirkungen von Aluminiumhydroxid auszugehen. Neben der unterschiedlichen genetischen Toleranz gegenüber Aluminium ist auch die Vorbelastung mit Aluminium nicht bei allen Menschen gleich groß. Allein durch die Nahrungsaufnahme kann eine Grundbelastung mit Aluminium erfolgen, die die empfohlenen Grenzwerte überschreitet: Die europäische Lebensmittelaufsichtsbehörde EFSA gab bereits 2008 bekannt, dass die tolerierbare wöchentliche Aufnahmemenge (Tolerable Weekly Intake, TWI) von 1 mg Aluminium/kg KG voraussichtlich bei einem relevanten Anteil der europäischen Bevölkerung überschritten wird. Auch PD Dr. Detlef Wölfl e vom Bundesinstitut für Risikobewertung (BfR) sagt, dass das Problem darin bestehe, dass „die Gesamtaufnahme, die tolerable Aufnahme, die von der Europäischen Behörde für Lebensmittel festgesetzt worden ist, überschreiten kann.“ Man kann also nicht davon ausgehen, dass jeder Mensch, der eine SKI mit aluminiumhaltigen Adjuvanzien erhalten soll, aufgrund seiner genetischen Prädisposition und aufgrund seiner individuellen Vorbelastung, diese langfristig auch tolerieren wird. Das Bundesinstitut für Risikobewertung (BfR) weist auf das gesundheitliche Risiko von hohen Al-Belastungen hin. Dazu zählt das BfR: brüchige Knochen, Blutarmut, Hirnschädigungen sowie Störungen der Fortpfl anzung und des sich entwickelnden Nervensystems. Allerdings ist die Bewertung des neurotoxischen und krebsauslösenden Potentials von Aluminium noch nicht abgeschlossen. Im Jahr 1989 empfahl eine Experten-Komission der ‚Food and Agriculture Organization‘ der Vereinten Nationen (FAO) und der Weltgesundheits-Organisation (WHO) eine wöchentliche Aluminiumaufnahme von 7mg/kg Körpergewicht nicht zu überschreiten. Aufgrund der zunehmenden Erkenntnisse über mögliche Schä- digungen des Nervensystems und der Fortpfl anzungsfähigkeit, die durch Aluminium ausgelöst werden können, wurde die Empfehlung der TWIDosis im Jahr 2007 Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 57 – impf-report Nr. 109 4. Quartal 2015 Die Ursache dieser regelrechten Volksseuche wurde nach jahrelanger Forschung von uns gefunden und isoliert: Es handelt sich um das sogenannte „Leichtgläubigkeits-Virus“ (LGV). Wir entwickeln seit Jahren einen passenden Impfstoff dagegen und freuen uns, diesen nun kostenlos an alle, die sich von diesem Virus befreien wollen, abgeben zu können: Die Webseite impfkritik.de Wir haben nun eine globale Kampagne gestartet, das LGV bis spätestens 2025 auszurotten. impfkritik.de ist unseres Wissens der einzige Impfstoff , der sowohl von Fachleuten als auch von Laien verabreicht werden und gleichzeitig nahezu grenzenlos weitergereicht werden kann. Sorgen Sie also dafür, dass sich auch Ihre Umgebung (das sind alle Ihre Kontaktpersonen) gegen das LGV wappnet und impft. Damit senken Sie das Risiko einer Reinfektion enorm und erzielen gleichzeitig einen hohen Herdenschutz. Jetzt aber mal im Ernst: Haben Sie sich auch schon mal die Frage gestellt, ob die angeblichen Impferfolge nicht in Wahrheit auf einem reinen Placebo-Eff ekt beruhen? Natürlich erwarten Sie – und das zu Recht –, dass im Rahmen einer Zulassungsstudie der Placebo-Eff ekt ausgeschaltet wird und auch sonstige Manipulationen der Ergebnisse ausgeschlossen werden. Doch solche Placebo-Studien sind laut Herstellern und Gesundheitsbehörden „unethisch“, weil den Placebo-Geimpften ja ein gesundheitlicher Vorteil vorenthalten würde. Komischerweise stellt sich offenbar weltweit keiner der Impfexperten die Frage, was daran ethisch sein soll, einen „aus ethischen Gründen“ nicht ordentlich getesteten Impfstoff auf die Allgemeinheit, vor allem aber auf gesunde Säuglinge, loszulassen. Anstelle eines direkten Wirkungsnachweises in Form von Placebostudien zählt man ersatzweise die gegen einen bestimmten Erreger gebildeten Antikörper im Blut. Die messbare Anzahl dieser Antikörper zu vermehren ist alles, was die Impfungen tun. Doch Studien, die belegen, dass Menschen mit vielen Antiköpern auch tatsächlich einen gesundheitlichen Vorteil haben, sind den zuständigen Bundesbehörden gar nicht bekannt. Die Annahme, dass viele Antikörper viel Gesundheit bedeuten, beruht vielmehr auf über 100 Jahre alte Hypothesen der Schüler von Robert Koch. Bewiesen wurde das nie. Basiert das Impfen also auf einem wissenschaftlichen Mythos, der sich allein durch den inbrünstigen Glauben der Impfexperten aufrecht erhält? Noch eines, was mich nachdenklich macht: Die meisten Erkrankungs- und Todesfallstatistiken zeigen, dass der Rückgang der Seuchen lange vor Einführung der Massenimpfungen begann. Die Impfungen sprangen also auf einen längst fahrenden Zug auf. Sie sind gewissermaßen Trittbrettfahrer einer sich aus anderen Gründen seit Generationen verbessernden allgemeinen Gesundheit. Noch mehr Fragen und manche unbequeme Antworten fi nden Sie auf: http://www.impfkritik.de. deutlich nach unten korrigiert auf 1mg/kg. Im EU Weißbuch zur Chemikalienpolitik aus dem Jahr 2001 wird gefordert, dass bei Vorliegen zuverlässiger wissenschaftlicher Hinweise, dass ein chemischer Stoff nachteilige Auswirkungen auf die Gesundheit des Menschen und die Umwelt haben könnte, die politische Entscheidungsfi ndung auf dem Prinzip der Vorsorge fußen muss, um Schäden zu verhüten, auch wenn noch Ungewissheiten über die genauere Art und Schwere der möglichen Schäden bestehen. In gleicher Weise sollte auch das Prinzip der Vorsorge auf den Einsatz von Aluminium in Therapie-Allergenen angewendet werden, mit dem Ziel, Aluminiumhydroxid als Adjuvans aus den Therapieallergenen zu entfernen. Neuer Impfstoff gegen Volksseuche – Ausrottung bis 2025? Unwissenheit ist eine weit verbreitete hochinfektiöse Infektionskrankheit. Anstecken kann man sich insbesondere in Arztpraxen. Die Komplikationsrate bei einer erfolgten Infektion ist beachtlich – in den meisten Fällen hat sie Konsequenzen, auch wenn sie nicht gleich sichtbar sind, manchmal sind diese auch schwerwiegender Natur. Die Inkubationszeit liegt bei 1 und 10 Sekunden (bzw. die Zeit, die man braucht, um sich für oder gegen eine medizinische Maß- nahme zu entscheiden). Nachfolgend eine (fast) ernst gemeinte Nachricht über einen neuen Impfstoff, der uns alsbald aus der Patsche helfen soll. von Hans U. P. Tolzin * Worterklärungen CFS Abkürzung für „chronic fatique syndrome“ („chronisches Mü- digkeits-Syndrom) MMF Abkürzung für „makrophagische Myofasciitis“ (Muskelentzündung unter Beteiligung von Makrophagen) – 58 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Aluminiumhydroxid kommt in der Natur nicht in einer verfügbaren Form vor und wirkt als starkes Nervengift. Wird es unter Umgehung der natürlichen Abwehrmechanismen (in den Schleimhäuten und dem MagenDarm-Trakt) direkt in menschliches Gewebe injiziert, kann das Immunsystem bereits durch geringste Mengen in den größtmöglichen Alarmzustand versetzt werden. Da das Immunsystem Aluminium als gefährlich erkennt, jedoch nicht weiß, wie es damit umgehen soll, wenn es z. B. im Rahmen einer Impfung urplötzlich und unerwartet im Gewebe auftaucht, kann es zu Irritationen kommen, indem das Immunsystem andere Substanzen, mit denen es gleichzeitig konfrontiert wird, ebenfalls als gefährlich einstuft und angreift. Diese Reaktion ist von den Impfexperten grundsätzlich zwar gewollt, aber nicht wirklich steuerbar! So kann es passieren, dass der Organismus plötzlich auf Erdbeeren allergisch oder gar mit einem anaphylaktischen Schock reagiert, weil der Patient gerade Erdbeeren gegessen hat (Allergie). Oder das Immunsystem wendet sich sogar gegen körpereigenes Gewebe (Autoimmunerkrankung). Ein Autor hat das mal mit dem kräftigen Tritt gegen einen Bienenstock verglichen: Die Bienen stürzen sich auf das erstbeste Objekt in ihrer Reichweite, in der Annahme, dass es sich um die Ursache der Störung handelt. So stürzt sich das gleichzeitig alarmierte und irritierte Immunsystem auf die nächstbeste Substanz. Und manchmal handelt es sich hierbei eben um körpereigenes Gewebe. Literatur: Juli 2013: „Autoimmune/autoinfl ammatory syndrome induced by adjuvants (ASIA syndrome) in commercial sheep.“ Lluís Luján, Marta Pérez, Eider Salazar, Neila Álvarez, Marina Gimeno, Pedro Pinczowski, Silvia Irusta, Jesús Santamaría, et al., Immunologic Research. April 2013: „Autoimmune/infl ammatory syndrome induced by adjuvants (Shoenfeld‘s syndrome): clinical and immunological spectrum.“ VeraLastra O, Medina G, Cruz-Dominguez Mdel P, Jara LJ, Shoenfeld Y., April 2013: Video Q&A: what is ASIA? An interview with Yehuda Shoenfeld, http://www.biomedcentral.com Januar 2012: „The spectrum of ASIA: ‘Autoimmune (Auto-infl ammatory) Syndrome induced by Adjuvants‘.“ N Agmon-Levin, GRV Hughes, Y Shoenfeld Juni 2011: ASIA: „A New Way to Put the Puzzle Together.“ by Yehuda Shoenfeld, MD, FRCP, and Nancy Agmon Levine, MD Februar 2011: ‚ASIA‘ – autoimmune/ infl ammatory syndrome induced by adjuvants. Shoenfeld Y, Agmon-Levin N. ASIA – eine neue Impfkrankheit ASIA ist eine Abkürzung für „Autoimmune/autoinfl ammatory syndrome induced by adjuvants“, auf gut Deutsch „Durch Immunverstärker hervorgerufene Autoimmunerkrankung.“ Mit „Adjuvanzien“ bezeichnet man Zusatzstoffe, die eine Verstärkung der Abwehrreaktion („Immunreaktion“) bewirken sollen. Meistens handelt es sich hierbei um Aluminiumsalze, in der Regel um Aluminiumhydroxid. Diese Substanz ist in den meisten aktuellen Impfstoffen enthalten. von Hans U. P. Tolzin Wäre dies etwas für den Arzt oder Apotheker Ihres Vertrauens? (ht) Mehr als 200 Ärzte und Apotheker fordern öffentlich auf der Webseite http://www.dagia.org die Einhaltung von wissenschaftlichen Mindestkriterien bei der Zulassung von Impfstoffen. Das Ziel der Organisatoren sind mindestens 1.000 ärztliche Unterstützer aus jedem deutschsprachigen Land. Internationale Versionen der „10 Forderungen“ sind in Vorbereitung. Die DAGIA-Initiative beabsichtigt wird mit dieser Unterstützung im Rücken ab 2016 Gespräche mit Bundestagsabgeordneten führen. Auch wenn Sie kein Arzt oder Apotheker sind, können Sie die Initiative unterstützen, indem Sie das nebenstehende Unterstützer-Formular kopieren und beim nächsten Praxisbesuch Ihrem Arzt mitbringen. Wir wissen, dass sehr viele Ärzte diese Forderungen unterstützen würden – wenn sie nur über die Aktion informiert wären. Sie fi nden das Unterstützer-Formular auch auf der Webseite http://www.dagia.org. Dort können Sie es als PDF-Datei herunterladen und per Email weiterleiten. Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 59 – impf-report Nr. 109 4. Quartal 2015 7LWHO 9RUQDPHQ 1DPH )DFKDU]W“ELWWHDQJHEHQ$SRWKHNHU“ 3/= 2UW 6WUD‰H+DXVQU (PDLO7HOHIRQ)D[ 2UW’DWXP8QWHUVFKULIW 0LQGHVW$QIRUGHUXQJHQDQHYLGHQ]EDVLHUWH=XODVVXQJVVWXGLHQ ,PSIXQJHQJHOWHQDOVHLQHGHUJU|‰WHQ(UUXQJHQVFKDIWHQGHUPRGHUQHQ0HGL]LQ6LHVWHOOHQMHGRFKUHFKWOLFKJHVHKHQ .|USHUYHUOHW]XQJHQGDUGLHGDUXPGHUPQGLJHQ(LQZLOOLJXQJEHGUIHQ=XGHPKDQGHOWHVVLFKXPQLFKWXQPLWWHOEDU QRWZHQGLJHPHGL]LQLVFKH(LQJULIIHDQ*HVXQGHQ’HVKDOEVLQGEHVRQGHUVKRKH$QIRUGHUXQJHQDQLKUH=XODVVXQJ]X VWHOOHQ=LHOGLHVHU$QIRUGHUXQJHQPXVVVHLQHLQHGHXWOLFKHXQGVWDWLVWLVFK]XYHUOlVVLJH$XVVDJHEH]JOLFKHLQHVJH VXQGKHLWOLFKHQ9RUWHLOVYRQ*HLPSIWHQJHJHQEHU8QJHLPSIWHQWUHIIHQ]XN|QQHQ:LUIRUGHUQGHVKDOEGLH(LQKDOWXQJ HLQHV0LQGHVWVWDQGDUGV 5DQGRPLVLHUWHUSODFHERNRQWUROOLHUWHUXQGPHKUIDFKYHUEOLQGHWHU9HUJOHLFK]ZLVFKHQ*HLPSIWHQXQG8QJH LPSIWHQE]Z3ODFHER*HLPSIWHQ 6ROFKH6WXGLHQZHUGHQLQGHU5HJHOQLFKWGXUFKJHIKUWGHQQHVLVWDQJHEOLFKXQHWKLVFK3UREDQGHQEHZXVVWHLQHQ:LUNVWRIIYRU]XHQWKDOWHQ %HLHLQHPQRFKXQJHWHVWHWHQ,PSIVWRIINDQQPDQMHGRFKQLFKWYRQHLQHU:LUNVDPNHLWDXVJHKHQ,QWHUHVVDQWHUZHLVHVLQGYHUJOHLFKHQGH%OLQG VWXGLHQVHOEVWLP9HWHULQlUEHUHLFKQLFKWEOLFKREZRKOGDV(WKLN$UJXPHQWGRUWQLFKWJUHLIW$X‰HUGHPZHUGHQLQGHQOHW]WHQ-DKUHQVWlQGLJ ÄXQHWKLVFKH³$XVQDKPHQJHPDFKWVLHKH]%*DUGDVLO&HUYDUL[=RVWDYDF5RWDUL[‚DV(WKLN$UJXPHQWPDFKWNHLQHQ6LQQ =ZLQJHQGH(LQWUDJXQJLQHLQ|IIHQWOLFKHV6WXGLHQUHJLVWHU 9LHOH+HUVWHOOHUQHLJHQGD]X6WXGLHQPLWXQHUZQVFKWHQ(UJHEQLVVHQJDUQLFKWHUVW]XYHU|IIHQWOLFKHQ’DV)HKOHQHLQHU6WXGLHQUHJLVWHU9HU SÀLFKWXQJZLUGGHVKDOEVHLW-DKU]HKQWHQYRQ)DFKNUHLVHQXQGPHG)DFK]HLWVFKULIWHQEHPlQJHOW .HLQH6FKHLQ3ODFHERV 6FKHLQ3ODFHERVGLH,PSIVWRIIEHVWDQGWHLOH]%$OXPLQLXPK\GUR[LGHQWKDOWHQIKUHQ]XJUDYLHUHQGHQ9HU]HUUXQJHQGHU6WXGLHQHUJHEQLVVH $XVUHLFKHQGH*U|‰HXQG/DXI]HLW ‚LHPHLVWHQ6WXGLHQVLQG]XNOHLQXQGODXIHQQLFKWODQJHJHQXJXP]XYHUOlVVLJH’DWHQ]X:LUNVDPNHLWXQG6LFKHUKHLWOLHIHUQ]XN|QQHQ 7UDQVSDUHQ]GHV6WXGLHQGHVLJQV ‚DV6WXGLHQGHVLJQPLWVDPWDOOHQUHOHYDQWHQDQRQ\PLVLHUWHQ’DWHQGLHIUGLH%HXUWHLOXQJHLQHU6WXGLHZLFKWLJVLQGXQWHUOLHJWELVKHUJUXQG VlW]OLFKGHU*HKHLPKDOWXQJGXUFK%HK|UGHQXQG+HUVWHOOHU(LQH*HJHQSUIXQJGXUFKGLH)DFKZHOWZLUGGDGXUFKXQP|JOLFKJHPDFKW (UIDVVXQJDOOHUYHUIJEDUHU*HVXQGKHLWVSDUDPHWHU ‚XUFKGDVJH]LHOWH$XVZlKOHQEHVWLPPWHUNOLQLVFKHU(QGSXQNWHNDQQGDV(UJHEQLVHLQHU6WXGLHOHLFKWLQVHLQ*HJHQWHLOYHUNHKUWZHUGHQ 8QDEKlQJLJHU$QVSUHFKSDUWQHUIU3UREDQGHQ ‚HQQPDQFKH6WXGLHQlU]WHWHQGLHUHQHUIDKUXQJVJHPl‰GD]XP|JOLFKH,PSINRPSOLNDWLRQHQJHJHQEHU3UREDQGHQ]XEDJDWHOOLVLHUHQ )LQDQ]LHOOHXQGRUJDQLVDWRULVFKH8QDEKlQJLJNHLWYRP+HUVWHOOHU =DKOUHLFKH3XEOLNDWLRQHQEHOHJHQGDVVKHUVWHOOHU¿QDQ]LHUWH6WXGLHQWHQGHQ]L|VVLQG+LHUIUPXVVHLQH/|VXQJJHIXQGHQZHUGHQ 9|OOLJXQJHLPSIWH.RQWUROOJUXSSH 8P]XEHUSUIHQREGXUFKGLHVSH]LHOOHQ%HGLQJXQJHQGHU6WXGLHHLQIDOVFKHV%LOGGHU(SLGHPLRORJLHHU]HXJWZLUG 1DFKPDUNWVWXGLHQ 1DFKPDUNWVWXGLHQVLQGZLFKWLJXPGDV(UJHEQLVGHU=XODVVXQJVVWXGLHQ]XHUJlQ]HQRGHU]XNRUULJLHUHQ6LHVLQGELVKHUQLFKWYHUSÀLFKWHQG MDGDV3(,KDWDOVGHXWVFKH=XODVVXQJVEHK|UGHQRFKQLFKWHLQPDOHLQHQhEHUEOLFNEHUGLHYHUIJEDUHQ1DFKPDUNWVWXGLHQ ,FKELQ$U]W$SRWKHNHUXQGXQWHUVWW]HGLHREHQDXIJHIKUWHQ0LQGHVW$QIRUGHUXQJHQ0HL QH’DWHQTitel, Vorname, Name, PLZ, Ort, Facharzt/Apotheker) GUIHQ]XVDPPHQPLWGHU/LVWHGHU EHUHLWVH[LVWLHUHQGHQPHKUDOV8QWHUVWW]HUDXIZZZGDJLDRUJYHU|IIHQWOLFKWZHUGHQ %LWWHVFKUHLEHQ6LHGHXWOLFKE]ZOHVEDU 3UD[LVE]Z$SRWKHNHQVWHPSHO DAGIA ist die gemeinsame Plattform von Elterninitiativen, Ärzten und Apothekern, siehe auch http://www.dagia.org *Der Fachbeirat wird vor allen wichtigen Entscheidungen und Aktionen zu Rate gezogen ,FKP|FKWH’$*,$ ]XVlW]OLFKDOV0LW JOLHGGHV)DFKEHLUDWVXQWHUVWW]HQ )DFKEHLUDW’UPHG+DUWPXW%DOWLQ5RPDQ%DVWLDQ$SRWKHNHU)ORULDQ’DYLGLV$U]W-RVHI-‚LHUV.LQGHUDU]W -HWWH/LPEHUJ’LHUVbU]WLQ’U-HQ|(EHUW3URI’U’UPHG(QULFR(GLQJHU’U$UPLQ)UVW’UPHG+HLQ] *lUEHU’UPHG:HUQHU*UDXEHUJHU’UPHG0DUWLQ*VFKZHQGHU’UPHGGHQW2OLYHU+DPP%LUJLW+|UJHU bU]WLQ’UPHG,QJIULHG+REHUW%LUJLW+|UJHUbU]WLQ’UPHG&ODXV.|KQOHLQ5ROI.URQ$U]W’UPHG-UJHQ 1LHKDXV,QH]0DULD3DQGLWbU]WLQ’UPHG7KRPDV5DX’UPHG(U]VHEHW5HJHQVEXUJ’UPHG$QWRQ 6DODW’UPHG-UJHQ6FKPLGW+H\GW6LJLVPXQG36LHW]NH$U]W’UPHG/XLVH6WRO]0DQIUHGYDQ7UHHN$]W 3URI’U’USKLO+DUDOG:DODFK’UPHGYHW-XWWD=LHJOHU 6SUHFKHU$QGUHDV’LHPHU$U]WXQG’LSO3K\VLNHU(PDLOSUHVVH#GDJLDRUJ)RQ 6WDQG’H]HPEHU %LWWHHLQVHQGHQDQ’$*,$.RRUGLQDWLRQVVWHOOH:LGGHUVWHLQVWU+HUUHQEHUJ)D[LQIR#GDJLDRUJ dag a Deutsche Arbeitsgemeinschaft für unabhängige Impfaufklärung ‚$*,$LVW HLQH JHPHLQVDPH,QLWLDWLYH YRQ(OWHUQYHUElQGHQ bU]WHQ XQG$SRWKHNHUQ – 60 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Deutschland: 01445 Radebeul, Frau Seliger, kontakt@impfaufklaerung-radebeul.de; 02681 Wilthen; Konstanze Linert & Doreen Toppe; doreen.toppe@web.de / 02763 Zittau, Doreen und Sandra, impfaufklaerung-oberlausitz@freenet.de / 02977 Hoyerswerda; Ildiko Schenk; schenki1986@freenet.de / 04249 Leipzig; Sonja Riedel 0171-1972046 / 06114 Halle/ Saale; Hans-Peter Bartos 0345-2113344; nachrichten@bartos.info / 07819 Lemnitz; Jeannine Tänzler; jeantaenz@icloud. com / 09130 Chemnitz; Constanze Dittreich; constanze-dittrich@gmx.de / 10559 Berlin-Tiergarten; Frank Reitemeyer; impfen.nein.danke@gmail.com / 10717 Berlin (Wilmersdorf); Andrea Beitz-Ostermann; abostermann@yahoo.de / 12587 Berlin-Friedrichshagen; Astrid Pahl; 030-57702496; impf-info@astrid-pahl.de / 13125 Berlin-Karow + 13051 Berlin-Malchow; Katja Rückstieß und Brigitte Schulz; 030-89993804 / 21129 Hamburg (Neuenfelde); Daniela Gerlemann; 040-75118191; daniela.gerlemann@t-online.de / 21335 Lüneburg; Betina Jäckle; 04131-7436334 / 22880 Wedel; mw.impfen@gmx.de / 24576 Bad Bramstadt; Claudia Dobberstein; impf.frei.sh@web.de / 25421 Pinneberg; Jennifer Posdena; jennifer@posdena. de / 25980 Westerland; Hartwig Richter; hartwig.richter@t-online.de; 04651-3383926 / 26123 Oldenburg; efi -oldenburg@ web.de / 26871 Papenburg; Sabine Bette; efi papenburg@aol.com / 27568 Bremerhaven; Heike Winsemann; 0471-54050; info@morgenland-bremerhaven.de / 28857 Syke; claudia.birkholz@gmx.de, 0160-90124704 / 30161 Hannover; info@ naturheilpraxis-osterhage.de / 31840 Hessisch Oldendorf; Susanne Schirmer; 05152-5276275 heilungsimpulse@susanneschirmer.de / 34125 Kassel; Kontakt: Nicola Zoch; 05682-7359756, nicolazoch@hotmail.de / 34471 Volkmarsen; Claudia Papst-Dippel; 05693-1720 / 36381 Schlüchtern; Anita Weißenstein; 06661-919687; info@lrweissenstein.de / 39108 Magdeburg; Dietmar Fröhlich; 0391-8380803 / 42285 Wuppertal; Dieter Mauch; 0202-3721713 / 47279 Duisburg; Yvonne Koch; pinoantico@t-online.de / 49074 Osnabrück; Bettina Lünswilken; efi -osnabrueck@gmx.de / 50170 Kerpen; Andrea Schwarz-Delic; impffrei-im-rek@gmx.de / 51375 Leverkusen; Dirk Schade; 0151-58580888; 0214-7500261;impffrei@gmx. de / 53639 Königswinter; Zsuzsa Weinrowsky; info@privatkindergarten-vinxel.de / 54550 Daun; Yvonne Spieker; yspieker@ online.de / 63165 Mühlheim am Main; Ilona Arzt, ilona.arzt@gmx.de; 06108-792888 / 63607 Wächtersbach; Corina Rolofs; c.rolofs@t-online.de / 63897 Miltenberg; Dr. med. Erzsebet Regensburg; Fon 09371 66464 / 65183 Wiesbaden; Uwe Jakob; uwejakob@hotmail.com / 67547 Worms; impfkritisches-treffen-worms@gmx.de / 68753 Waghäusel; Nicole Mülayim; nicole.muelayim@t-online.de, Tel. 07254-958948 / 69918 Heidelberg; Sonia u. Thomas Rehehäuser; Fon 06221- 7259019; konten@rehehaeuser.de / 71083 Herrenberg; Hans U. P. Tolzin; hans@tolzin.de / 71560 Sulzbach a.d. Murr; 07192-902755 / 71566 Althütte; Isabella Schickart; 07183-9327502 / 72631 Aichtal; Tina Seyfert; tina@seyfert-haustechnik. de / 74081 Heilbronn; Walter Reiner; 07135-3373; walter.reiner@t-online.de / 80637 München; Dr. Claudia Mosavi; information-impfen@gmx.de / 81825 München; Heike Schippert; 08063-207380 / 83620 Feldkirchen; Heike Schippert; Tel. 08063-207380 / 84030 Ergolding/Landshut; Andrea Hilz; Tel. 08784-969895; Barbara Kollross; 0871-3307114 / 84048 Sandelzhausen; Fr. Traudte; 08751-3549 / 84048 Mainburg; Nancy Ludwig; 0151-20688582 / 84503 Altötting; Jürgen Rohracker; 08671-3070121 / 85049 Ingolstadt; 08421-903707 / 86150 Augsburg; Angelika Müller; efi @efi -online.de / 86899 Landsberg am Lech; levana-landsberg@gmx.de / 88696 Owingen; Marita Lauser; 0160-2979811; stammtisch@baiker.eu / 89522 Heidenheim; efi -heidenheim@web.de / 91217 Hersbruck; Fam. Liedel; 0160-97731080; impfkritikerstammtischhersbruck@gmx-topmail.de / 91278 Pottenstein; Kerstin Wende; 0179-5764822 / 91550 Dinkelsbühl; Gasthaus Weib’s Brauhaus jeden 1. Mittwoch im Monat; 20 Uhr / 92224 Amberg; impfen-amberg@gmx.de / 92318 Pölling bei Neumarkt; Ingrid Weber; Tel; 09181 / 440129 / 92533 Wernberg-Köblitz; Marion Kammer; st-wernberg@live.de / 93128 Regenstauf; Marion Kammer; st-regenstauf@live.de / 94239 Gotteszell; Michael Sommerauer; Fon 09929-9575979; sommerauer@tonline.de / 97508 Grettstadt; Susanne Nies; 09729-7589948; info@globuligesund.de / 99867 Gotha; Jessica König oder Stephanie Herrmann; 0157-84575457 oder impfkritischer-stammtisch@gmx.de / Die jeweils aktuelle Liste fi nden Sie unter http://www.impfkritik.de/stammtische Österreich: 3100 St. Pölten; Ingrid Weber; 02744-67181; weber-ingrid@aon.at / 3324 Euratsfeld; Verein „rundumgsund“; Fon 0650-9501050; rundumgsund@gmx.at / 3430 Tulln; Dr. Voglsam; 02272-6709521 / 4040 Linz; Eva Orliger; Fon 0664-9762808 / 4902 Wolfsegg am Hausruck; Barbara Schampach; Fon 0680-2014066; mbschampach@gmx.at / 5020 Salzburg; Cortiel Petra; impformation@aon.at; 0662-872264 ; http://www.wahrheitsnetz.com/kalender / 6460 Imst; Annette Fritz-Stoffaneller; Fon 0664-73461520 / 6845 Hohenems; Antje Uccia/Jochum; antje@kugelbauch.at / 8045 Graz; Maria Bienwald; Fon 0316-696159 oder 0664-88416696 / 9863 Rennweg; Heymans Adrian GBB; 04734/314; adrianheymans@ aon.at / 9900 Tristach; Dr. Ladstätter; 04852/70723. 0676/5193063; dr.franz.m.ladstaetter@direkt.at / Rückfragen bitte an AEGIS Österreich, info@aegis.at Schweiz: 3011 Bern; Justine Stähelin; uti_d@yahoo.com / 3267 Seedorf; Gudrun Nobs; 032-3922530; Judith Moser; 032-3927234 / 3706 Leissigen; Christine Furrer; 033-8470753 / 3763 Därstetten/Interlaken; Barbara Martin; 033-783 2631 / 3904 Naters; Olivia Kuonen; 027-9241417 / 3930 Visp; Sabrina Heizmann; 027-946-6542 / 4312 Magden; Ruedi Kaiser; 061-8412212; r.kaiser@bluewin.ch / 4800 Zofi ngen; Monika Kunz; 062-7582169 / 5303 Würenlingen; J. Vonderach-Millat; 056-2457350; Janine Kramer; 056-2421902 / 6004 Luzern; Dominik Huber; Tel. 041-2660071 / 6313 Menzingen; Marlene und Jakob Rupp-Arnold; 041-7553327; 079-4356890 / 6440 Altdorf; Silvia Philipp; 041-8709510; silvia.philipp@gmx.ch / 6802 Rivera; Andrea Sabina Di Ninno; 091-8578753; Rebecca Prosperi; 091-6054058 / 7000 Chur; Simona Brot Nutt; 081-6514076; Riccarda Menghini Sutter; 081-2504281 / 7502 Bever; Susanne Reisinger; 078-8326290; info@engadinkinder.ch / 8253 Diessenhofen; Elvira Jegen; 052-6572088; elvira.jegen@shinternet.ch / 8272 Ermatingen; Hildegund Hohl; 071-4552291; hildegund.hohl@impfentscheid.ch / 8306 Brüttisellen; Simone Wiedersheim; 078-6781765; info@simonewiedersheim.ch / 8500 Frauenfeld TG; Anita Bader; nhp.aba@gmx.ch / 8597 Landschlacht; Claudio Graf; 071-6800930; claudio.graf@impfentscheid.ch / 8620 Wetzikon; Brigitte Brunner; 043-4970858; 079-3646010 / 8864 Reichenburg; Marlén Lanitz; Tel. 079-3290500; kiwishome@gmx.ch / 8910 Affoltern a. A.; Helga Werder; 056-6709403 / 9240 Uzwil; Rahel Dönni; praxis.doenni@bluewin.ch / 9470 Buchs; Claudia Senn; 079-4735584; claudia.senn@impfentscheid.ch / 9607 Mosnang; Maya Länziger; 071-9831227; 079-7408678 / Die jeweils aktuelle Liste fi nden Sie unter http://www.impfkreise.eu! Impfkritische Gesprächskreise und Stammtische Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 61 – impf-report Nr. 109 4. Quartal 2015 Adressen & Links Eltern für Impfaufklärung (EFI) Eine Initiative von Angelika Müller (vormals Kögel-Schauz) D-86316 Friedberg, Heideweg 7 Email: efi @efi -online.de http://www.efi -online.de Libertas & Sanitas e.V. Geschäftsstelle: Postfach 1205, D-85066 Eichstätt, Fon +49 (0) 8421 903707, Fax: +49 (0) 8421 99761 Email: info@libertas-sanitas.de http://www.libertas-sanitas.de Interessengemeinschaft für gesunde Tiere e.V. http://www.ig-gesunde-tiere.de Gesundheit + Impffreiheit für Tiere e.V. D-67480 Edenkoben Friedrich-Andrae-Str. 6 Fon +49 (0) 6323/2895 Email: info@impffreiheit.de http://www.impffreiheit.de AEGIS Österreich Frau Franziska Loibner A-8563 Ligist, Ligist 89 Fax +43 (0)3143 29734 Email: info@aegis.at http://www.aegis.at Ärzte und Ärzteverbände: http://www.impf-info.de Dr. med. Steffen Rabe, München http://www.impfo.ch Schweizer Arbeitsgruppe für differenzierte Impfungen http://www.individuelleimpfentscheidung.de „Ärzte für individuelle Impfentschei dung e.V.“ http://www.kron-rolf.de Rolf Kron, praktischer Arzt Sonstige informative Webseiten: http://www.ehgartner.blogspot.de/ http://www.impfkritik.de http://www.groma.ch http://www.impfschaden.info/ http://www.balance-online.de/inhaltthemen-geschaeft.htm http://www.impfen-nein-danke.de Weitere Internetverweise fi nden Sie auf http://www.impfkritik.de Veranstaltungshinweise Deutschland 8. Dez. 2015 / 71083 Herrenberg / Spitalgasse 20, Praxis Dr. Walker / 18:30 bis 20:30 Uhr / Vortrag Hans U. P. Tolzin: „Was wissen wir über die Sicherheit von Impfstoffen?“ / verbindliche Anmeldung erforderlich (begrenzter Platz): Fon 07032/6688, arzt6688@aol.com 12. Dez. 2015 / 65185 Wiesbaden / Kaiser-Friedrich-Ring 77 (Arztpraxis) / 10 – 14 Uhr / Intensivseminar für Therapeuten: „Das Impfen im komplexen Ablauf der Immunologie“ mit Alfons Meyer (Arzt), Dr. Oliver Feyen / Info: Fon 0611/2055280, natuerlich@alfonsmeyer.de 12. März 2016 / „10. Chemnitzer Impfsymposium“ mit Rolf Kron (Arzt), Dr. päd. Angela Söldner (HP), Hans U. P. Tolzin (Medizin-Journalist), Joachim Hegemann (Veranstalter) / Info: Fon 0371/304620, svhgev@gmail.com 9./10 April 2016 / „11. Stuttgarter Impfsymposium“ mit Dr. med. Andrew Wakefi eld, GB/USA, Andreas Diemer (Arzt), Alfons Meyer (Arzt), Angelika Müller (EFI), Marion Kammer (Dipl.-Päd.), Hans U. P. Tolzin (Medizin-Journalist) / Info: 07032/7848491, buero@impf-report.de 26. April 2016 / 82318 Murnau / Kulturzentrum Kohlgruberstr. 1 / 20 Uhr / Vortrag von Hans U. P. Tolzin, Journalist: „Die drei Säulen einer mündigen Impfentscheidung“ / Info: info@naturheilverein-oberland.de, www. naturheilverein-oberland.de 15./16. Okt. 2016 / Vogelsberg (Hessen) / Deutsches Impfkritikertreffen / Anmeldung erforderlich: buero@impf-report.de Österreich 27. Nov. 2015 / 6845 Hohenems / Gasthof Habsburg in Hohenems, Graf-Maximilian-Str. 19 / Impfstammtisch ab 19:30 Uhr / Info: antje@kugelbauch.at 13. Feb. 2016 / Münchendorf bei Wien / ab 9 Uhr / Seminar mit Dr. Johann Loibner: „Impfen Ja oder Nein?“ / Info: a.gross@cranio-sakral.at, Fon 0664/222 0204 Schweiz 2. Dez. 2015 / Eisenwerk Frauenfeld, Salon Rouge / 19:30 bis 21:30 Uhr / Naturheilpraktikerin Anita Bader „Grundlagen für den eigenen Impfentscheid“ / Info: nhp.aba@gmx.ch, Fon 052/552 4528 / Anmeldung erforderlich 16. Dez. 2015 / Eisenwerk Frauenfeld, Salon Rouge / 19:30 bis 21:30 Uhr / Naturheilpraktikerin Anita Bader „Grundlagen für den eigenen Impfentscheid“ / Info: nhp.aba@gmx.ch, Fon 052/552 4528 / Anmeldung erforderlich Siehe auch: http://www.impfkritik.de/veranstaltungen – 62 – Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de 4. Quartal 2015 impf-report Nr. 109 Wir trauern um Gertrud Alexander Im Alter von 70 Jahren verstarb im Oktober 2015 die ehemalige 2. Vorsitzende des Schutzverbandes für Impfgeschädigte e.V., Frau Gertrud Alexander. Ihr Tod hat mich sehr erschüttert. Gertrud war seit dem Jahre 2000 bis Juli 2015 in ihrer Vereinsfunktion tätig und betreute während dieser Zeit viele Vereinsmitglieder in Verwaltungsund Gerichtsverfahren, um so die staatliche Anerkennung eines Impfschadens zu erhalten. Sie war einer der hilfsbereitesten, ehrlichsten und fl eißigsten Menschen, die ich kannte. Sie hat ihr Leben vollständig und ehrenamtlich in den Dienst des Schutzverbandes gestellt. Betroff ene, sowohl als Mitglieder des Vereins als auch als Anfragende, wurden von ihr jederzeit mit Rat und Tat unterstützt. Um den Betroff enen vor Gericht zur Anerkennung des Schadens und zur Gewährung von Leistungen verhelfen zu können, hat sie unermüdlich die neuesten wissenschaftlichen Quellen studiert. Ihr enormes Wissen war unter Impfkritikern geschätzt. Ihre gesamte Familie hat sie bei ihrer aufopferungsvollen Aufgabe unterstützt, obwohl der Sohn der Familie Alexander eine schwerste Behinderung durch eine Impfung erlitten hat und viel Zeit für Pfl ege in Anspruch nahm und nimmt. Meine langjährige Freundin und ehemalige erste Vorsitzende des Schutzverbandes, Frau Heike Brebeck, sagte mir zu dem viel zu frühen Tod Gertruds: „Die jahrelange Vorstandsarbeit mit Gerti war eine schö- ne und wertvolle Zeit für mich. Sie war mit ihrem großen Fachwissen eine Bereicherung des Schutzverbandes, ebenso mit ihrer Hilfe und Unterstützung gegenüber den Mitgliedern in ihren Anerkennungsverfahren. Trotz ihres aufopfernden Arbeitseinsatzes hatte Gerti immer ein offenes Ohr und mitfühlende Worte, nicht nur für die betroff enen Mitglieder. Für mich war Gerti ein besonders hilfsbereiter und wertvoller Mensch. Ihre eigenen Interessen stellte sie immer für ihre ehrenamtliche Tätigkeit in den Hintergrund. Ich werde Gerti vermissen.“ Gertrud Alexander war über viele Jahre 2. Vorsitzende des Schutzverband für Impfgeschädigte e.V. und selbst Mutter eines schwerst impfgeschädigten Sohnes (hier mit ihrem Enkelkind) Foto: privat Meine allergrößte Hochachtung gilt Gertrud und mein ganzes Mitgefühl ihrer Familie. Sie hinterlässt eine große Lücke, sowohl im Kreise der Impfgeschädigten als auch in ihrer Familie. Angelika Müller (vorm. Kögel-Schauz) EFI, Eltern für Impfaufklärung Hans Tolzin Verlag • 71083 Herrenberg • Widdersteinstr. 8 • Fon 07032/784 849-1 • Fax -2 • http://www.impf-report.de – 63 – impf-report Nr. 109 4. Quartal 2015 Verbindliche Anmeldung für das 11. Stuttgarter Impfsymposium am 9./10. April 2016 Hiermit melde ich an: [ ] mich [ ] uns als Paar [ ] ich bin Schüler/Student/HartzIV/Behindert ____________________________________________________________________________ Bemerkungen Ich überweise den fälligen Betrag von € __________ bis zum _________________ auf Ihr Konto. Ich benötige eine Kinderbetreuung für _______________________________, ________ Jahre alt. Ich werde am Sonntag am Workshop teilnehmen: [ ] ja [ ] vielleicht [ ] nein Mir ist bekannt, dass Sie bei Stornierungen bis zum 1. April 2016 10 Euro Bearbeitungsgebühr einbehalten bzw. dass nach dem 1. April 2016 die Teilnahmegebühr verfällt, es sei denn, ich kann einen Ersatzteilnehmer stellen. _______________________________________________________________________________ Name, Vorname, Straße, PLZ Ort (bitte deutlich schreiben!) _______________________________________________________________________________ Beruf, Fon/Fax, Email (bitte deutlich schreiben!) _______________________________________________________________________________ Ort, Datum, Unterschrift %LWWHHLQVHQGHQDQ impf-report, 71083 Herrenberg, Widdersteinstr. 8, Fon 07032/784 849-1, Fax -2, buero@impf-report.de, .RQWR Inh. Hans Tolzin, Nr.: 379 500 000, BLZ 603 913 10, Volksbank Herrenberg IBAN: IBAN DE60 6039 1310 0379 5000 00, BIC GENODES1VBH Bitte vergessen Sie nicht, den/die Namen bei Ihrer Überweisung anzugeben, damit eine eindeutige Zuordnung möglich ist! Anmeldefrist* bis 1. Nov. 2015 bis 1. Feb. 2016 bis 1. April 2016 Tageskasse Einzelanmeldung 80,00 € 90,00 € 100,00 € 110,00 € Paare** 100,00 € 110,00 € 120,00 € 130,00 € Schüler,Studenten Hartz-IV, Behinderte*** 50,00 € 55,00 € 60,00 € 65,00 € * Für die fristgerechte Anmeldung gilt das Datum des Zahlungseingangs auf unserem Konto ** mit gemeinsamen Haushalt *** mit Nachweis Teilnahmegebühren (für Samstag und Sonntag) =HLWHQ Die auf der Vorderseite aufgeführten Vorträge beginnen am Samstag, den 9. April 2016 um 9:00 Uhr und enden um 19:00 Uhr. Danach ist Abendessen und gemütliches Beisammensein. ZusätzOLFK]XVHLQHP9RUWUDJDP6DPVWDJELHWHW’U:DNH¿HOGDP6RQQWDJYRQ8KUELV8KUHLQHQ Workshop an. Es ist keine Simultanübersetzung geplant, gute Englischkenntnisse sind empfehlenswert. Dieser Workshop ist in o. g. Teilnahmegebühren inbegriffen. Eine separate Buchung des Workshops ist leider nicht möglich. Nach Zahlungseingang erhalten Sie von uns per Email, oder, wenn keine Emailadresse angegeben ist, per Post eine Anmeldebestätigung mit Anfahrtsbeschreibung und einer Liste nahegelegener Hotels. 9HUSÀHJXQJ Während der Veranstaltung werden wir wie gewohnt vom Restaurant der Halle verkö- stigt (nicht in den Teilnahmegebühren inbegriffen). 9./10. April 2016 11. Stuttgarter http://www.impf-report.de Impfsymposium Kritisches Forum zur Impfproblematik Teilnahmegebühren XQG$QPHOGXQJ Alle Preise incl. 19 % MwSt. 9./10. April 2016 http://www.impf-report.de Revolutionäre Erkenntnisse der Immunologie – und die Konsequenzen Alfons Meyer, niedergelassener Arzt in Wiesbaden und ein profunder Kenner der Immunologie und ihrer neuesten Forschungsergebnisse. Er wird in seinem Vortrag darlegen, was wir inzwischen über das Immunsystem wissen, warum die derzeitig Impfpolitik auf veralteten Modellen beruht und welche Möglichkeiten der aktuelle Wissensstand für die Vorbeugung und Therapie bei Infektionskrankheiten eröffnet. Wie wissenschaftlich sind die Zulassungsstudien von Impfstoffen? Andreas Diemer, Arzt und Dipl.-Physiker aus Gernsbach im Schwarzwald. In seinem Vortrag beleuchtet er die wissenschaftlichen Mindestanforderungen an Zulassungsstudien von Impfstoffen und inwieweit diese in der Realität umgesetzt werden. Er ist Sprecher der DAGIA-Initiative (derzeit 200 deutschsprachige Ärzte und Apotheker) deren „10 Mindest-Anforderungen“ auf Anfragen basieren, die er vor Jahren an die deutsche Zulassungsbehörde richtete. Impfungen und Autismus: Gibt es einen Zusammenhang? ‚U$QGUHZ:DNH¿HOGDer britische Arzt löste mit seiner 1998 im Lancet veröffentlichten Studie eine bis heute andauernde weltweite Debatte über dem möglichen Zusammenhang zwischen Impfungen und Autismus aus. Nach einer beispiellosen Hetzkampagne in den Medien wurde die Publikation zurückJH]RJHQXQG:DNH¿HOGGLH$SSUREDWLRQHQW]RJHQ:DNH¿HOGEHULFKWHWEHUGLH+LQWHUJUQGHXQGGHQ aktuellen Stand der Forschung (mit Übersetzung). Warum eine Ungleichbehandlung Ungeimpfter rechtswidrig ist + Aktuelle Analyse staatlicher Studiendaten: Ungeimpfte sind gesünder! Angelika Müller (vorm. Kögel-Schauz), ist Software-Ingenierin, Mutter von 4 Kindern und beschäftigt sich seit etwa 20 Jahren mit der Impffrage. Sie ist Initiatorin der Initiative „Eltern für Impfaufklärung“ (EFI), ZZZH¿RQOLQHGH, gilt als eine der kompetentesten Impfkritikerinnen im deutschen Sprachraum und veröffentlicht regelmäßige Analysen zu aktuellen Impfempfehlungen. Schütteltrauma oder Impffolge? Marion Kammer’LSO6R]LDOSlGDJRJLQ9RUVWDQGVPLWJOLHGEHL$*%8*H90XWWHUXQG3ÀHJHPXWWHU betreut Familien, denen ihre Säuglinge mit der Diagnose „Schütteltrauma“ vom Jugendamt weggenommen wurden, obwohl die Symptome auf einen Impfschaden hindeuten. In ihrem Vortrag beschreibt sie, wie man ein Schütteltrauma eindeutig von einem Impfschaden unterscheiden kann und welche juristischen Möglichkeiten betroffene Eltern haben, ihr Kind zurückzuholen. Aktuelle Berichte und Frage-Antwort-Runde mit allen Referenten Moderation: HP Silke Reichenbach Wir haben uns diesen Zeitrahmen freigehalten, um über aktuelle Entwicklungen zu berichten, z. B. neue Impfempfehlungen, die Zulassung neuer Impfstoffe oder juristische Fragen. Im zweiten Teil stehen die Referenten für die Fragen des Publikums zur Verfügung. Freiheit der Impfentsch